EDIL3/DEL1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

EDIL3/DEL1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EDIL3/DEL1
  
  

  Source: E.coli

  Amino Acid Sequence: QRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCEL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: EDIL3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24809It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EDIL3/DEL1 Recombinant Protein Antigen

• DEL1
• DEL1developmental endothelial locus-1
• Developmentally-regulated endothelial cell locus 1 protein
• EDIL3
• EGF-like repeat and discoidin I-like domain-containing protein 3
• EGF-like repeats and discoidin I-like domains 3
• Integrin-binding protein DEL1
• MGC26287

Background

Del-1 is an integrin ligand, containing an EGF-like domain, that is expressed by endothelial cells during embryological vascular development. It promotes adhesion of endothelial cells through an interaction with the alpha-v/beta-3 integrin receptor. DEL1 plays a vital role in mediating angiogenesis, and is thought to help regulate vascular morphogenesis of remodeling in embryonic development.

DEL 1 antibodies are usefull tools for angiogenesis research and endothelial cell adhesion studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EDIL3