ECE-2 Antibody

Images

 
Immunohistochemistry-Paraffin: ECE-2 Antibody [NBP1-81495] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: ECE-2 Antibody [NBP1-81495] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: ECE-2 Antibody [NBP1-81495] - Staining in human adrenal gland and endometrium tissues using anti-ECE2 antibody. Corresponding ECE2 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ECE-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IYDMIGFPDFILEPKELDDVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQW
Specificity
Specificity of human ECE-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ECE-2 Protein (NBP1-81495PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ECE-2 Antibody

  • EC 3.4.24
  • EC 3.4.24.71
  • ECE2
  • ECE-2
  • endothelin converting enzyme 2
  • endothelin-converting enzyme 2
  • KIAA0604MGC2408
  • MGC17664
  • MGC78487

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1784
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICFlow
AF1182
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5579
Species: Hu
Applications: ICC
NLS54
Species: Hu, Mu, Ca
Applications: WB, ICC/IF, IHC-P, ICC
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-66907
Species: Hu, Mu, Rt, Fi, Ze
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
8090-ZN
Species: Hu
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ECE-2 Antibody (NBP1-81495) (0)

There are no publications for ECE-2 Antibody (NBP1-81495).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECE-2 Antibody (NBP1-81495) (0)

There are no reviews for ECE-2 Antibody (NBP1-81495). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ECE-2 Antibody (NBP1-81495) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ECE-2 Antibody (NBP1-81495)

Discover related pathways, diseases and genes to ECE-2 Antibody (NBP1-81495). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECE-2 Antibody (NBP1-81495)

Discover more about diseases related to ECE-2 Antibody (NBP1-81495).
 

Pathways for ECE-2 Antibody (NBP1-81495)

View related products by pathway.

Blogs on ECE-2

There are no specific blogs for ECE-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECE-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECE2
Entrez