ECE-2 Antibody

Images

 
Western Blot: ECE2 Antibody [NBP1-69061] - Rat Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ECE-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to Ece2 (endothelin-converting enzyme 2) The peptide sequence was selected from the middle region of Ece2. Peptide sequence YMVELGMLLGGQPTSTRAQMQQVLELEIQLATITVPQDQRRDEEKIYHKM.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ece2 and was validated on Western blot.
Theoretical MW
86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ECE-2 Antibody

  • EC 3.4.24
  • EC 3.4.24.71
  • ECE2
  • ECE-2
  • endothelin converting enzyme 2
  • endothelin-converting enzyme 2
  • KIAA0604MGC2408
  • MGC17664
  • MGC78487

Background

The function of Ece2 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1784
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICFlow
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB5579
Species: Hu
Applications: ICC
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
8090-ZN
Species: Hu
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF6567
Species: Hu, Mu
Applications: WB, IHC
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ECE-2 Antibody (NBP1-69061) (0)

There are no publications for ECE-2 Antibody (NBP1-69061).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECE-2 Antibody (NBP1-69061) (0)

There are no reviews for ECE-2 Antibody (NBP1-69061). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ECE-2 Antibody (NBP1-69061) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECE-2 Products

Bioinformatics Tool for ECE-2 Antibody (NBP1-69061)

Discover related pathways, diseases and genes to ECE-2 Antibody (NBP1-69061). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECE-2 Antibody (NBP1-69061)

Discover more about diseases related to ECE-2 Antibody (NBP1-69061).
 

Pathways for ECE-2 Antibody (NBP1-69061)

View related products by pathway.

Blogs on ECE-2

There are no specific blogs for ECE-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECE-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECE2
Entrez
Uniprot