EBF-3 Antibody

Images

 
Western Blot: EBF3 Antibody [NBP1-82378] - Rat Lung lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EBF-3 Antibody Summary

Immunogen
Synthetic peptide towards Ebf3. Peptide sequence MNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
Ebf3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Ebf3 and was validated on Western blot.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EBF-3 Antibody

  • COE3
  • COE3OE-2
  • DKFZp667B0210
  • early B-cell factor 3O/E-2
  • EBF3
  • EBF-3
  • OE-2
  • Olf-1/EBF-like 2
  • transcription factor COE3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5165
Species: Hu, Mu
Applications: WB
NBP2-75477
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83090
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF7006
Species: Hu, Mu
Applications: WB, IHC
MAB8398
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1555
Species: Hu
Applications: WB
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00056899-P01
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
AF7068
Species: Hu
Applications: WB, IHC, ICC
H00009167-B02P
Species: Hu
Applications: WB, ELISA

Publications for EBF-3 Antibody (NBP1-82378) (0)

There are no publications for EBF-3 Antibody (NBP1-82378).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EBF-3 Antibody (NBP1-82378) (0)

There are no reviews for EBF-3 Antibody (NBP1-82378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EBF-3 Antibody (NBP1-82378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EBF-3 Antibody (NBP1-82378)

Discover related pathways, diseases and genes to EBF-3 Antibody (NBP1-82378). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EBF-3 Antibody (NBP1-82378)

Discover more about diseases related to EBF-3 Antibody (NBP1-82378).
 

Pathways for EBF-3 Antibody (NBP1-82378)

View related products by pathway.

PTMs for EBF-3 Antibody (NBP1-82378)

Learn more about PTMs related to EBF-3 Antibody (NBP1-82378).

Blogs on EBF-3

There are no specific blogs for EBF-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EBF-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol Ebf3
Uniprot