EAR2/NR2F6 Antibody


Western Blot: EAR2/NR2F6 Antibody [NBP2-86624] - WB Suggested Anti-NR2F6 Antibody. Titration: 5 ug/ml. Positive Control: HepG2 Whole CellNR2F6 is strongly supported by BioGPS gene expression data to be expressed in ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

EAR2/NR2F6 Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of human EAR2/NR2F6. Peptide sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Protein A purified

Alternate Names for EAR2/NR2F6 Antibody

  • EAR2
  • EAR-2ERBA-related gene-2
  • EAR2nuclear receptor subfamily 2 group F member 6
  • ERBAL2
  • ERBAL2v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 2
  • NR2F6
  • nuclear receptor subfamily 2, group F, member 6
  • V-erbA-related protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
Species: Ch
Applications: ELISA, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB

Publications for EAR2/NR2F6 Antibody (NBP2-86624) (0)

There are no publications for EAR2/NR2F6 Antibody (NBP2-86624).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EAR2/NR2F6 Antibody (NBP2-86624) (0)

There are no reviews for EAR2/NR2F6 Antibody (NBP2-86624). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EAR2/NR2F6 Antibody (NBP2-86624) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EAR2/NR2F6 Products

Bioinformatics Tool for EAR2/NR2F6 Antibody (NBP2-86624)

Discover related pathways, diseases and genes to EAR2/NR2F6 Antibody (NBP2-86624). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EAR2/NR2F6 Antibody (NBP2-86624)

Discover more about diseases related to EAR2/NR2F6 Antibody (NBP2-86624).

Pathways for EAR2/NR2F6 Antibody (NBP2-86624)

View related products by pathway.

PTMs for EAR2/NR2F6 Antibody (NBP2-86624)

Learn more about PTMs related to EAR2/NR2F6 Antibody (NBP2-86624).

Blogs on EAR2/NR2F6

There are no specific blogs for EAR2/NR2F6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EAR2/NR2F6 Antibody and receive a gift card or discount.


Gene Symbol NR2F6