EAR2/NR2F6 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit EAR2/NR2F6 Antibody - BSA Free (NBP2-86623) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human EAR2/NR2F6. Peptide sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NR2F6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for EAR2/NR2F6 Antibody - BSA Free
Background
EAR2 is a nuclear orphan receptor related to the ERB-A superfamily and the COUP-TF family of transcription factors. EAR2 has been shown to be a transcriptional co-repressor of the lutenizing hormone receptor and the thyroid hormone receptor. It has also been shown to associate with negative transcription regulatory elements, and repress promoter activity. Alternate names for EAR2 include nuclear receptor subfamily 2 group F member 6, orphan nuclear receptor EAR-2, V-erbA-related protein, NR2F6, and ERBAL2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: IHC, IP, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, IHC
Publications for EAR2/NR2F6 Antibody (NBP2-86623) (0)
There are no publications for EAR2/NR2F6 Antibody (NBP2-86623).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EAR2/NR2F6 Antibody (NBP2-86623) (0)
There are no reviews for EAR2/NR2F6 Antibody (NBP2-86623).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EAR2/NR2F6 Antibody (NBP2-86623) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EAR2/NR2F6 Products
Blogs on EAR2/NR2F6