EAAT3 Antibody [CoraFluor™ 1] Summary
| Description |
CoraFluor(TM) 1 is a high performance terbium-based TR-FRET (Time-Resolved Fluorescence Resonance Energy Transfer) or TRF (Time-Resolved Fluorescence) donor for high throughput assay development. CoraFluor(TM) 1 absorbs UV light at approximately 340 nm, and emits at approximately 490 nm, 545 nm, 585 nm and 620 nm. It is compatible with common acceptor dyes that absorb at the emission wavelengths of CoraFluor(TM) 1. CoraFluor(TM) 1 can be used for the development of robust and scalable TR-FRET binding assays such as target engagement, ternary complex, protein-protein interaction and protein quantification assays.
CoraFluor(TM) 1, amine reactive
CoraFluor(TM) 1, thiol reactive
For more information, please see our CoraFluor(TM) TR-FRET technology flyer. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 430-524 of human EAAT3 (NP_004161.4).
Sequence: SIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC1A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. Do not freeze. |
| Buffer |
PBS |
| Preservative |
No Preservative |
| Purity |
Affinity purified |
Notes
CoraFluor (TM) is a trademark of Bio-Techne Corp. Sold for research purposes only under agreement from Massachusetts General Hospital. US patent 2022/0025254
Alternate Names for EAAT3 Antibody [CoraFluor™ 1]
Background
The EAAT3 gene encodes for glutamate transporters (also known as excitatory amino acid transporters, EAATs), that rapidly move glutamate from the postsynaptic cleft through the plasma membrane. The proteins are approximately 542 amino acids long at a mass barely over 57 kDA. This function allows for neurotoxic levels of glutamate in the brain to be avoided. It is common to see underactivity of glutamate receptors in some disorders such as ischemia and traumatic brain injuries and overactivity to be linked to mental illnesses such as schizophrenia. EAAT3 gene is also related to obsessive-compulsive disorder, ganglioglioma, autism spectrum disorders, aminoaciduriam temporal lobe epilepsy, hepatic encephalopathy, neuronitis, anorexia nervosa, and amyotrophic lateral sclerosis. It interacts with KNCN, HCCS, EWSR1, PRKCA, and ARL6IP5 to function in pathways of glutamic acid signaling, transmembrane transport of small molecules, and protein digestion and absorption.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, In vivo, ISH, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for EAAT3 Antibody (NBP3-38021CL1) (0)
There are no publications for EAAT3 Antibody (NBP3-38021CL1).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EAAT3 Antibody (NBP3-38021CL1) (0)
There are no reviews for EAAT3 Antibody (NBP3-38021CL1).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EAAT3 Antibody (NBP3-38021CL1) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EAAT3 Products
Research Areas for EAAT3 Antibody (NBP3-38021CL1)
Find related products by research area.
|
Blogs on EAAT3