EAAT3 Antibody [Alexa Fluor® 647]

Images

 

Product Details

Summary
Product Discontinued
View other related EAAT3 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38021AF647
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EAAT3 Antibody [Alexa Fluor® 647] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 430-524 of human EAAT3 (NP_004161.4).

Sequence:
SIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC1A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for EAAT3 Antibody [Alexa Fluor® 647]

  • EAAC1
  • EAAC1excitatory amino acid carrier 1
  • EAAT3
  • EAAT3excitatory amino acid transporter 3
  • Excitatory amino-acid carrier 1
  • Neuronal and epithelial glutamate transporter
  • SLC1A1
  • Sodium-dependent glutamate/aspartate transporter 3
  • solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1
  • Solute carrier family 1 member 1

Background

The EAAT3 gene encodes for glutamate transporters (also known as excitatory amino acid transporters, EAATs), that rapidly move glutamate from the postsynaptic cleft through the plasma membrane. The proteins are approximately 542 amino acids long at a mass barely over 57 kDA. This function allows for neurotoxic levels of glutamate in the brain to be avoided. It is common to see underactivity of glutamate receptors in some disorders such as ischemia and traumatic brain injuries and overactivity to be linked to mental illnesses such as schizophrenia. EAAT3 gene is also related to obsessive-compulsive disorder, ganglioglioma, autism spectrum disorders, aminoaciduriam temporal lobe epilepsy, hepatic encephalopathy, neuronitis, anorexia nervosa, and amyotrophic lateral sclerosis. It interacts with KNCN, HCCS, EWSR1, PRKCA, and ARL6IP5 to function in pathways of glutamic acid signaling, transmembrane transport of small molecules, and protein digestion and absorption.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1869
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-20136
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, In vivo, ISH, WB
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91803
Species: Hu
Applications: IHC,  IHC-P, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP3-12158
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-81802
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-13165
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NLS892
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC,  IHC-P, WB
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-75510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38021AF647
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for EAAT3 Antibody (NBP3-38021AF647) (0)

There are no publications for EAAT3 Antibody (NBP3-38021AF647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EAAT3 Antibody (NBP3-38021AF647) (0)

There are no reviews for EAAT3 Antibody (NBP3-38021AF647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EAAT3 Antibody (NBP3-38021AF647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EAAT3 Antibody [Alexa Fluor® 647] and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC1A1