The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to SLC1A2(solute carrier family 1 (glial high affinity glutamate transporter), member 2) The peptide sequence was selected from the N terminal of SLC1A2 (NP_004162). PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTK The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC1A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
62 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-59632 in the following applications:
Mouse reactivity reported in scientific literature (PMID: 29880832).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for EAAT2/GLT1 Antibody - BSA Free
EAAT2
GLT1
member 2
SLC1A2
solute carrier family 1 (glial high affinity glutamate transporter), member 2
Solute carrier family 1 member 2
Background
SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for EAAT2/GLT1 Antibody (NBP1-59632). (Showing 1 - 1 of 1 FAQs).
Can you please advise if NBP1-59632, GLT1 Antibody, will work on denatured protein?
This antibody has been generated using a synthetic peptides corresponding to a sequence from the N terminal of SLC1A2 (NP_004162). PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPE. In general, the antibodies generated against partial peptides binds to proteins in their denatured form and in WB, this antibody was validated under reducing and denaturing conditions at our end. However, because the antigen sequence corresponds to the extracellular topological domain and the antibody worked perfectly in IHC as well (where protein targets are more in their native state), I assume that in WB also, this antibody should be able to detect GLT1 in its native state.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our EAAT2/GLT1 Antibody - BSA Free and receive a gift card or discount.