E74 like factor 1 Antibody - BSA Free

Immunohistochemistry: E74 like factor 1 Antibody [NBP3-10893] - Immunohistochemical analysis of spleen.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

E74 like factor 1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit E74 like factor 1 Antibody - BSA Free (NBP3-10893) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human E74 like factor 1 (NP_758961). Peptide sequence VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 67 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for E74 like factor 1 Antibody - BSA Free

• E74-like factor 1 (ets domain transcription factor)
• E74-like factor 1
• ETS-related transcription factor Elf-1

Background

E74-like factor 1 (ELF1) is a member of the ETS (e26 transformation specific sequence) family of proteins, contains an ETS-domain, and shares sequence identity with the Drosophila ecdysone inducible E74 transcription factor. ETS was originally identified in the E26 retroviral isolate that led to the discovery of c-ets-1 (cellular ets-1), a cellular oncogenic transcription factor capable of transforming cells. Like ETS, ELF-1 functions as a transcription factor and has been shown to bind promoter and enhancer elements in a number of immunity responsive genes. ELF-1 is highly expressed in B-cells and appears to play an integral role in B-cell gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELF1