E74 like factor 1 Antibody

Images

 
Immunohistochemistry: E74 like factor 1 Antibody [NBP3-10893] - Immunohistochemical analysis of spleen.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

E74 like factor 1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human E74 like factor 1 (NP_758961). Peptide sequence VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT
Clonality
Polyclonal
Host
Rabbit
Gene
ELF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for E74 like factor 1 Antibody

  • E74-like factor 1 (ets domain transcription factor)
  • E74-like factor 1
  • ETS-related transcription factor Elf-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

8415-A2
Species: Mu
Applications: BA
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-84770
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
202-IL
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
NBP1-87925
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16500
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-45543
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-10893
Species: Hu
Applications: WB, IHC

Publications for E74 like factor 1 Antibody (NBP3-10893) (0)

There are no publications for E74 like factor 1 Antibody (NBP3-10893).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E74 like factor 1 Antibody (NBP3-10893) (0)

There are no reviews for E74 like factor 1 Antibody (NBP3-10893). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for E74 like factor 1 Antibody (NBP3-10893) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional E74 like factor 1 Products

Bioinformatics Tool for E74 like factor 1 Antibody (NBP3-10893)

Discover related pathways, diseases and genes to E74 like factor 1 Antibody (NBP3-10893). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E74 like factor 1 Antibody (NBP3-10893)

Discover more about diseases related to E74 like factor 1 Antibody (NBP3-10893).
 

Pathways for E74 like factor 1 Antibody (NBP3-10893)

View related products by pathway.

PTMs for E74 like factor 1 Antibody (NBP3-10893)

Learn more about PTMs related to E74 like factor 1 Antibody (NBP3-10893).
 

Research Areas for E74 like factor 1 Antibody (NBP3-10893)

Find related products by research area.

Blogs on E74 like factor 1

There are no specific blogs for E74 like factor 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our E74 like factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELF1