Recombinant Human Dystonin Protein

Images

 
SDS-Page: Recombinant Human Dystonin Protein [H00000667-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Dystonin Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 401-500 of Human Dystonin

Source: Wheat Germ

Amino Acid Sequence: EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DST
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dystonin Protein

  • 230 kDa bullous pemphigoid antigen
  • BP240
  • BPAFLJ30627
  • BPAG1FLJ32235
  • Bullous pemphigoid antigen 1
  • bullous pemphigoid antigen 1, 230/240kDa
  • Bullous pemphigoid antigen
  • CATX-15
  • D6S1101
  • DKFZp564B2416
  • DMHCATX15
  • DT
  • Dystonia musculorum protein
  • dystonin
  • FLJ13425
  • FLJ21489
  • FLJ46791
  • Hemidesmosomal plaque protein
  • KIAA0465
  • KIAA0728
  • KIAA1470
  • MACF2
  • trabeculin-beta

Background

DST - dystonin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33412
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
259-HE/CF
Species: Hu
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00000667-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Dystonin Partial Recombinant Protein (H00000667-Q01) (0)

There are no publications for Dystonin Partial Recombinant Protein (H00000667-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dystonin Partial Recombinant Protein (H00000667-Q01) (0)

There are no reviews for Dystonin Partial Recombinant Protein (H00000667-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dystonin Partial Recombinant Protein (H00000667-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Dystonin Partial Recombinant Protein (H00000667-Q01)

Discover related pathways, diseases and genes to Dystonin Partial Recombinant Protein (H00000667-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dystonin Partial Recombinant Protein (H00000667-Q01)

Discover more about diseases related to Dystonin Partial Recombinant Protein (H00000667-Q01).
 

Pathways for Dystonin Partial Recombinant Protein (H00000667-Q01)

View related products by pathway.

PTMs for Dystonin Partial Recombinant Protein (H00000667-Q01)

Learn more about PTMs related to Dystonin Partial Recombinant Protein (H00000667-Q01).
 

Research Areas for Dystonin Partial Recombinant Protein (H00000667-Q01)

Find related products by research area.

Blogs on Dystonin

There are no specific blogs for Dystonin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Dystonin Antibody (H5E.Hy.4B)
DDX0450P-100-0.05mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dystonin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DST