DYNC1I2 Antibody


Western Blot: DYNC1I2 Antibody [NBP1-56998] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DYNC1I2 Antibody Summary

Synthetic peptides corresponding to DYNC1I2 (dynein, cytoplasmic 1, intermediate chain 2) The peptide sequence was selected from the N terminal of DYNC1I2. Peptide sequence VAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DYNC1I2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DYNC1I2 Antibody

  • cytoplasmic dynein 1 intermediate chain 2
  • Cytoplasmic dynein intermediate chain 2
  • DH IC-2
  • DNCI2MGC104199
  • DNCIC2
  • Dynein intermediate chain 2, cytosolic
  • dynein, cytoplasmic 1, intermediate chain 2
  • dynein, cytoplasmic, intermediate polypeptide 2
  • FLJ21089
  • FLJ90842
  • IC2
  • MGC111094
  • MGC9324


DYNC1I2 acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. Involved in membrane-transport, such as Golgi apparatus, late endosomes and lysosomes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Dr, Ma, Xp
Applications: WB, Flow, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for DYNC1I2 Antibody (NBP1-56998) (0)

There are no publications for DYNC1I2 Antibody (NBP1-56998).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYNC1I2 Antibody (NBP1-56998) (0)

There are no reviews for DYNC1I2 Antibody (NBP1-56998). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DYNC1I2 Antibody (NBP1-56998) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DYNC1I2 Products

Bioinformatics Tool for DYNC1I2 Antibody (NBP1-56998)

Discover related pathways, diseases and genes to DYNC1I2 Antibody (NBP1-56998). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DYNC1I2 Antibody (NBP1-56998)

Discover more about diseases related to DYNC1I2 Antibody (NBP1-56998).

Pathways for DYNC1I2 Antibody (NBP1-56998)

View related products by pathway.

Blogs on DYNC1I2

There are no specific blogs for DYNC1I2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DYNC1I2 Antibody and receive a gift card or discount.


Gene Symbol DYNC1I2