DUSP27 dual specificity phosphatase 27 Antibody

Immunohistochemistry-Paraffin: DUSP27 dual specificity phosphatase 27 Antibody [NBP1-86472] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Product Discontinued

DUSP27 dual specificity phosphatase 27 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EALMTVRKKRAIYPNEGFLKQLRELNEKLMEER
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUSP27
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DUSP27 dual specificity phosphatase 27 Antibody

• dual specificity phosphatase 27 (putative)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DUSP27