DUSP19 Antibody

Images

 
Western Blot: DUSP19 Antibody [NBP1-84041] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: DUSP19 Antibody [NBP1-84041] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUSP19 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DUSP19 Protein (NBP1-84041PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUSP19 Antibody

  • dual specificity phosphatase 19
  • Dual specificity phosphatase TS-DSP1
  • dual specificity protein phosphatase 19
  • DUSP17SAPK pathway-regulating phosphatase 1
  • EC 3.1.3.16
  • EC 3.1.3.48
  • LMWDSP3
  • LMW-DSP3
  • Low molecular weight dual specificity phosphatase 3
  • Protein phosphatase SKRP1
  • SKRP1MGC138210
  • Stress-activated protein kinase pathway-regulating phosphatase 1
  • TS-DSP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37542
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-01340
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB4457
Species: Hu, Mu, Rt
Applications: WB
MAB1654
Species: Hu, Mu, Rt
Applications: WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-03339
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56481
Species: Hu, Bv, Pm
Applications: WB
NBP2-13827
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84041
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DUSP19 Antibody (NBP1-84041) (0)

There are no publications for DUSP19 Antibody (NBP1-84041).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP19 Antibody (NBP1-84041) (0)

There are no reviews for DUSP19 Antibody (NBP1-84041). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUSP19 Antibody (NBP1-84041) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP19 Products

Bioinformatics Tool for DUSP19 Antibody (NBP1-84041)

Discover related pathways, diseases and genes to DUSP19 Antibody (NBP1-84041). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DUSP19 Antibody (NBP1-84041)

View related products by pathway.

PTMs for DUSP19 Antibody (NBP1-84041)

Learn more about PTMs related to DUSP19 Antibody (NBP1-84041).

Blogs on DUSP19

There are no specific blogs for DUSP19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP19