DUOX1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DUOX1 Antibody - BSA Free (NBP2-87306) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human DUOX1. Peptide sequence: LLVGAWTPLGAQNPISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DUOX1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DUOX1 Antibody - BSA Free
Background
The DUOX1 gene encodes a glycoprotein dual oxidase 1 protein with an isoform 1 of 1,551 amino acids long at 177 kDA and an isoform 2 at 1,197 amino acids long at 137 kDA. This protein is called a dual oxidase because it obtains a peroxidase homology domain and a gp91phox domain. DUOX1 generates hydrogen peroxide which is essential for thyroid peroxidase/TPO and lactoperoxidase/LPO, as well as lactoperoxidase-mediated antimicrobial defense. DUOX1 interacts with genes TXNDC11 and TPO and has been investigated for its role in various diseases such as thyroiditis, lung cancer, alcoholism, carcinoma, chronic obstructive pulmonary disease, hypothyroidism, hepatitis, prostatitis, and chronic granulomatous disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Publications for DUOX1 Antibody (NBP2-87306) (0)
There are no publications for DUOX1 Antibody (NBP2-87306).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DUOX1 Antibody (NBP2-87306) (0)
There are no reviews for DUOX1 Antibody (NBP2-87306).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DUOX1 Antibody (NBP2-87306) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DUOX1 Products
Blogs on DUOX1