DTX3 Antibody

Images

 
Western Blot: DTX3 Antibody [NBP1-69022] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Brain.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DTX3 Antibody Summary

Immunogen
Synthetic peptides corresponding to Dtx3 (deltex 3 homolog (Drosophila)) The peptide sequence was selected from the C terminal of Dtx3. Peptide sequence YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Dtx3 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DTX3 Antibody

  • deltex 3 homolog (Drosophila)
  • deltex homolog 3 (Drosophila)
  • deltex3
  • FLJ34766
  • MGC138863
  • MGC138864
  • protein deltex-3
  • RING finger protein 154
  • RNF154deltex 3 homolog

Background

Dtx3 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Dtx3 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context. Dtx3 functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7157
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-13941
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91612
Species: Mu
Applications: WB
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-83302
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
MAB7650
Species: Mu
Applications: WB, IHC
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for DTX3 Antibody (NBP1-69022) (0)

There are no publications for DTX3 Antibody (NBP1-69022).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTX3 Antibody (NBP1-69022) (0)

There are no reviews for DTX3 Antibody (NBP1-69022). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DTX3 Antibody (NBP1-69022) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DTX3 Products

Bioinformatics Tool for DTX3 Antibody (NBP1-69022)

Discover related pathways, diseases and genes to DTX3 Antibody (NBP1-69022). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTX3 Antibody (NBP1-69022)

Discover more about diseases related to DTX3 Antibody (NBP1-69022).

PTMs for DTX3 Antibody (NBP1-69022)

Learn more about PTMs related to DTX3 Antibody (NBP1-69022).

Blogs on DTX3

There are no specific blogs for DTX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DTX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTX3
Uniprot