DSPG3/EPYC Antibody - BSA Free

Immunohistochemistry-Paraffin: DSPG3/EPYC Antibody [NBP2-33445] - Staining of human prostate shows moderate cytoplasmic positivity in a subset of glandular cells.

Immunohistochemistry-Paraffin: DSPG3/EPYC Antibody [NBP2-33445] - Staining of human placenta shows moderate cytoplasmic positivity in decidual cells and strong positivity in trophoblast.

Immunohistochemistry-Paraffin: DSPG3/EPYC Antibody [NBP2-33445] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DSPG3/EPYC Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPYC
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DSPG3/EPYC Protein (NBP2-33445PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DSPG3/EPYC Antibody - BSA Free

• Dermatan sulfate proteoglycan 3dermatan sulphate proteoglycan 3
• DSPG3
• DSPG3proteoglycan-lb
• Epiphycan
• EPYC
• PGLB
• PG-Lb
• Proteoglycan-Lb
• SLRR3B
• SLRR3Bepiphycan proteoglycan
• Small chondroitin/dermatan sulfate proteoglycan

Background

Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DSPG3/EPYC Antibody (NBP2-33445)(1)

Publication using NBP2-33445

• Yu H, Tang D, Wu H et al. Integrated single-cell analyses decode the developmental landscape of the human fetal spine iScience 2022-06-01 [PMID: 35832888] (IF/IHC, Human)
  
  Details:
  Multiplexed immunofluoescence staining

Bioinformatics

• Gene Symbol: EPYC
• Uniprot:
  • Q99645()