DRAM Antibody - BSA Free

Western Blot: DRAM Antibody [NBP2-88807] - WB Suggested Anti-DRAM Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: A549 cell lysateDRAM1 is supported by BioGPS gene expression data to be expressed in A549

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DRAM Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DRAM Antibody - BSA Free (NBP2-88807) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human DRAM. Peptide sequence: TMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DRAM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DRAM Antibody - BSA Free

• Damage-regulated autophagy modulator
• DNA damage-regulated autophagy modulator protein 1
• DNA-damage regulated autophagy modulator 1
• DRAMFLJ11259

Background

DRAM is regulated as part of the p53 tumor suppressor pathway. The gene encodes a lysosomal membrane protein that is required for the induction of autophagy by the pathway. Decreased transcriptional expression of this gene is associated with various tumors. This gene has a pseudogene on chromosome 4.; Lysosomal modulator of autophagy that plays a central role in p53/TP53-mediated apoptosis. Not involved in p73/TP73-mediated autophagy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DRAM1