DPPA4 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKVLCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DPPA4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DPPA4 Antibody - BSA Free
Background
DPPA4, also known as Developmental pluripotency-associated protein 4, is a 33.5 kDa, 304 amino acid protein that is involved in inhibition of embryonic cells differentiation and maintenance of target genes' active epigenetic status. Current research is being conducted on diseases such as embryonal and other forms of carcinoma. The protein interacts with RPS6KB1, VIM, DPPA2, PTPRO, and SH3GL3. Pathways of the protein are unknown.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for DPPA4 Antibody (NBP2-48633) (0)
There are no publications for DPPA4 Antibody (NBP2-48633).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DPPA4 Antibody (NBP2-48633) (0)
There are no reviews for DPPA4 Antibody (NBP2-48633).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DPPA4 Antibody (NBP2-48633) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DPPA4 Products
Research Areas for DPPA4 Antibody (NBP2-48633)
Find related products by research area.
|
Blogs on DPPA4