DPPA4 Antibody

Images

 
Western Blot: DPPA4 Antibody [NBP2-48633] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line NTERA-2
Immunocytochemistry/ Immunofluorescence: DPPA4 Antibody [NBP2-48633] - Staining of human cell line AF22 shows localization to nucleus, nucleoli & plasma membrane.
Immunohistochemistry-Paraffin: DPPA4 Antibody [NBP2-48633] - Staining of human testis shows nuclear positivity in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPPA4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSIKGSKVLCPKKKAEHTDNPRPQKKIPIPPLPSKLPPVNLIHRD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPPA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DPPA4 Recombinant Protein Antigen (NBP2-48633PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPPA4 Antibody

  • developmental pluripotency associated 4
  • developmental pluripotency-associated protein 4
  • DPPA4
  • FLJ10713,2410091M23Rik

Background

DPPA4, also known as Developmental pluripotency-associated protein 4, is a 33.5 kDa, 304 amino acid protein that is involved in inhibition of embryonic cells differentiation and maintenance of target genes' active epigenetic status. Current research is being conducted on diseases such as embryonal and other forms of carcinoma. The protein interacts with RPS6KB1, VIM, DPPA2, PTPRO, and SH3GL3. Pathways of the protein are unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-98808
Species: Hu
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
H00388112-B01P
Species: Hu
Applications: WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, WB
AF3757
Species: Hu
Applications: ICC, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-37357
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84863
Species: Hu
Applications: IHC, IHC-P, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
746-LF/CF
Species: Hu
Applications: BA
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB994
Species: Mu
Applications: WB
NBP2-45603
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-48633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DPPA4 Antibody (NBP2-48633) (0)

There are no publications for DPPA4 Antibody (NBP2-48633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPPA4 Antibody (NBP2-48633) (0)

There are no reviews for DPPA4 Antibody (NBP2-48633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DPPA4 Antibody (NBP2-48633) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPPA4 Products

Bioinformatics Tool for DPPA4 Antibody (NBP2-48633)

Discover related pathways, diseases and genes to DPPA4 Antibody (NBP2-48633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPPA4 Antibody (NBP2-48633)

Discover more about diseases related to DPPA4 Antibody (NBP2-48633).
 

Pathways for DPPA4 Antibody (NBP2-48633)

View related products by pathway.

PTMs for DPPA4 Antibody (NBP2-48633)

Learn more about PTMs related to DPPA4 Antibody (NBP2-48633).
 

Research Areas for DPPA4 Antibody (NBP2-48633)

Find related products by research area.

Blogs on DPPA4

There are no specific blogs for DPPA4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPPA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPPA4