DPP6 Antibody - BSA Free

Western Blot: DPP6 Antibody [NBP2-47481] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse ventral tegmental area shows immunoreactivity in neuronal cell bodies.

Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481] - Staining of human cerebral cortex shows distinct positivity in neuropil.

Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481] - Staining of hippocampus tissue. Shows positivity in neuropil.

Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481] - Staining of human Analysis of hippocampus tissue. Shows strong immunoreactivity in neuropil.

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse cerebellum shows positivity in Purkinje cells.

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining hippocampus tissue. Shows immunoreactivity in the CA3 layer.

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse olfactory bulb shows immunoreactivity processes in the external plexiform layer.

Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse somatosensory cortex shows selective labeling in a subset of neurons.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DPP6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DPP6 Antibody - BSA Free (NBP2-47481) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPP6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DPP6 Protein (NBP2-47481PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DPP6 Antibody - BSA Free

• dipeptidyl aminopeptidase IV-related protein
• dipeptidyl aminopeptidase-like protein 6
• Dipeptidyl aminopeptidase-related protein
• Dipeptidyl peptidase 6
• Dipeptidyl peptidase IV-like protein
• dipeptidyl peptidase IV-related protein
• Dipeptidyl peptidase VI
• dipeptidylpeptidase 6
• dipeptidyl-peptidase 6
• dipeptidylpeptidase VI
• DPP VI
• DPP6
• DPPX
• DPPXFLJ55680
• MGC46605
• VF2

Background

The Anthrax toxin receptor (ATR) was initially discovered as the tumor endothelial marker 8 (TEM8). This protein, which exists in three isoforms (36, 40, and 60 kDa), is highly expressed in tumor vessels as well as in the vasculature of developing embryos, suggesting that it may normally play a role in angiogenesis. However, it also acts as the receptor for anthrax toxin. Following the binding of this protein by the protective antigen (PA) of anthrax, PA is cleaved and heptamerizes to form the binding site for both edema factor (EF) and lethal factor (LF). This complex is then endocytosed by the cell; acidification in endosomes allows the release of EF and LF into the cytoplasm where they interfere with MAPK signaling and induce apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPP6