DPP6 Antibody


Western Blot: DPP6 Antibody [NBP2-47481] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: DPP6 Antibody [NBP2-47481] - Staining mouse ventral tegmental area shows immunoreactivity in neuronal cell bodies.
Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining of human Analysis of hippocampus tissue. Shows strong immunoreactivity in neuropil.
Immunocytochemistry/ Immunofluorescence: DPP6 Antibody [NBP2-47481] - Staining mouse cerebellum shows positivity in Purkinje cells.
Immunocytochemistry/ Immunofluorescence: DPP6 Antibody [NBP2-47481] - Staining hippocampus tissue. Shows immunoreactivity in the CA3 layer.
Immunocytochemistry/ Immunofluorescence: DPP6 Antibody [NBP2-47481] - Staining mouse olfactory bulb shows immunoreactivity processes in the external plexiform layer.
Immunocytochemistry/ Immunofluorescence: DPP6 Antibody [NBP2-47481] - Staining mouse somatosensory cortex shows selective labeling in a subset of neurons.
Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining of human cerebral cortex shows distinct positivity in neuropil.
Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining of hippocampus tissue. Shows positivity in neuropil.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

DPP6 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DPP6 Protein (NBP2-47481PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DPP6 Antibody

  • dipeptidyl aminopeptidase IV-related protein
  • dipeptidyl aminopeptidase-like protein 6
  • Dipeptidyl aminopeptidase-related protein
  • Dipeptidyl peptidase 6
  • Dipeptidyl peptidase IV-like protein
  • dipeptidyl peptidase IV-related protein
  • Dipeptidyl peptidase VI
  • dipeptidylpeptidase 6
  • dipeptidyl-peptidase 6
  • dipeptidylpeptidase VI
  • DPP VI
  • DPP6
  • DPPX
  • DPPXFLJ55680
  • MGC46605
  • VF2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Po, Bv
Applications: WB
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Simple Western, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DPP6 Antibody (NBP2-47481) (0)

There are no publications for DPP6 Antibody (NBP2-47481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPP6 Antibody (NBP2-47481) (0)

There are no reviews for DPP6 Antibody (NBP2-47481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DPP6 Antibody (NBP2-47481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DPP6 Products

Bioinformatics Tool for DPP6 Antibody (NBP2-47481)

Discover related pathways, diseases and genes to DPP6 Antibody (NBP2-47481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPP6 Antibody (NBP2-47481)

Discover more about diseases related to DPP6 Antibody (NBP2-47481).

Pathways for DPP6 Antibody (NBP2-47481)

View related products by pathway.

PTMs for DPP6 Antibody (NBP2-47481)

Learn more about PTMs related to DPP6 Antibody (NBP2-47481).

Blogs on DPP6.

The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence.  Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation.  Gene silencing in DNA ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DPP6 Antibody and receive a gift card or discount.


Gene Symbol DPP6