DPP6 Antibody

Images

 
Western Blot: DPP6 Antibody [NBP2-47481] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse ventral tegmental area shows immunoreactivity in neuronal cell bodies.
Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481] - Staining of human cerebral cortex shows distinct positivity in neuropil.
Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481] - Staining of hippocampus tissue. Shows positivity in neuropil.
Immunohistochemistry-Paraffin: DPP6 Antibody [NBP2-47481] - Staining of human Analysis of hippocampus tissue. Shows strong immunoreactivity in neuropil.
Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse cerebellum shows positivity in Purkinje cells.
Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining hippocampus tissue. Shows immunoreactivity in the CA3 layer.
Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse olfactory bulb shows immunoreactivity processes in the external plexiform layer.
Immunohistochemistry: DPP6 Antibody [NBP2-47481] - Staining mouse somatosensory cortex shows selective labeling in a subset of neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPP6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DPP6 Protein (NBP2-47481PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPP6 Antibody

  • dipeptidyl aminopeptidase IV-related protein
  • dipeptidyl aminopeptidase-like protein 6
  • Dipeptidyl aminopeptidase-related protein
  • Dipeptidyl peptidase 6
  • Dipeptidyl peptidase IV-like protein
  • dipeptidyl peptidase IV-related protein
  • Dipeptidyl peptidase VI
  • dipeptidylpeptidase 6
  • dipeptidyl-peptidase 6
  • dipeptidylpeptidase VI
  • DPP VI
  • DPP6
  • DPPX
  • DPPXFLJ55680
  • MGC46605
  • VF2

Background

The Anthrax toxin receptor (ATR) was initially discovered as the tumor endothelial marker 8 (TEM8). This protein, which exists in three isoforms (36, 40, and 60 kDa), is highly expressed in tumor vessels as well as in the vasculature of developing embryos, suggesting that it may normally play a role in angiogenesis. However, it also acts as the receptor for anthrax toxin. Following the binding of this protein by the protective antigen (PA) of anthrax, PA is cleaved and heptamerizes to form the binding site for both edema factor (EF) and lethal factor (LF). This complex is then endocytosed by the cell; acidification in endosomes allows the release of EF and LF into the cytoplasm where they interfere with MAPK signaling and induce apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01249
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP3-03748
Species: Mu
Applications: IHC, IHC-P, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-279
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
H00030819-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP1-81336
Species: Hu, In
Applications: IHC, IHC-P, WB
NBP2-01830
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-61010
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IP, RIA, WB
AF3715
Species: Hu
Applications: IHC, IP, KO, Simple Western, WB
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB
NBP2-01521
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00030818-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP2-19020
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
NB100-2466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-47481
Species: Hu, Mu
Applications: WB, IHC

Publications for DPP6 Antibody (NBP2-47481) (0)

There are no publications for DPP6 Antibody (NBP2-47481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPP6 Antibody (NBP2-47481) (0)

There are no reviews for DPP6 Antibody (NBP2-47481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPP6 Antibody (NBP2-47481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPP6 Products

Bioinformatics Tool for DPP6 Antibody (NBP2-47481)

Discover related pathways, diseases and genes to DPP6 Antibody (NBP2-47481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPP6 Antibody (NBP2-47481)

Discover more about diseases related to DPP6 Antibody (NBP2-47481).
 

Pathways for DPP6 Antibody (NBP2-47481)

View related products by pathway.

PTMs for DPP6 Antibody (NBP2-47481)

Learn more about PTMs related to DPP6 Antibody (NBP2-47481).

Blogs on DPP6.

The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence.  Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation.  Gene silencing in DNA ...  Read full blog post.

mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPP6