Kv4.1 Antibody

Images

 
Western Blot: Kv4.1 Antibody [NBP1-81336] - Analysis in control (vector only transfected HEK293T lysate) and KCND1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Kv4.1 Antibody [NBP1-81336] - Staining of human cerebellum shows moderate positivity in granular layer.

Product Details

Summary
Reactivity Hu, In, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv4.1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NTLDRYPDTLLGSSEKEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAFYGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQ
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCND1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kv4.1 Protein (NBP1-81336PEP)
Publications
Read Publication using
NBP1-81336 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Invertebrate reported in scientific literature (PMID:32821839).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kv4.1 Antibody

  • Kv4.1
  • potassium voltage-gated channel subfamily D member 1
  • potassium voltage-gated channel, Shal-related subfamily, member 1
  • shal-type potassium channel
  • voltage-gated potassium channel Kv4.1
  • Voltage-gated potassium channel subunit Kv4.1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This gene is expressed at moderate levels in all tissues analyzed, with lower levels in skeletal muscle. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-03748
Species: Mu
Applications: IHC, IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003739-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
NBP2-85189
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-19020
Species: Bv, Hu, Mu, Po, Rt
Applications: WB
NBP2-48533
Species: Hu
Applications: IHC, IHC-P
NBP3-10293
Species: Hu
Applications: WB
NBP3-03729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
H00030819-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP2-47481
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00003748-M01
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-98145
Species: Hu
Applications: IHC-P
NBP2-01249
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for Kv4.1 Antibody (NBP1-81336)(1)

We have publications tested in 1 confirmed species: Invertebrate.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Invertebrate
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-81336 Applications Species
Yang S, Wang Y, Wang L et al. Target switch of centipede toxins for antagonistic switch Sci Adv 2020-08-01 [PMID: 32821839] (WB, Invertebrate) WB Invertebrate

Reviews for Kv4.1 Antibody (NBP1-81336) (0)

There are no reviews for Kv4.1 Antibody (NBP1-81336). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv4.1 Antibody (NBP1-81336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv4.1 Products

Bioinformatics Tool for Kv4.1 Antibody (NBP1-81336)

Discover related pathways, diseases and genes to Kv4.1 Antibody (NBP1-81336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv4.1 Antibody (NBP1-81336)

Discover more about diseases related to Kv4.1 Antibody (NBP1-81336).
 

Pathways for Kv4.1 Antibody (NBP1-81336)

View related products by pathway.

Research Areas for Kv4.1 Antibody (NBP1-81336)

Find related products by research area.

Blogs on Kv4.1

There are no specific blogs for Kv4.1, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv4.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCND1