DP1 Antibody (3E4)

Images

 
Sandwich ELISA: DP1 Antibody (3E4) [H00007027-M02] - Detection limit for recombinant GST tagged TFDP1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3E4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DP1 Antibody (3E4) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
TFDP1 (NP_009042.1, 112 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQ
Specificity
Reacts with transcription factor Dp-1.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TFDP1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DP1 Antibody (3E4)

  • DP1E2F dimerization partner 1
  • DRTF1Dp-1
  • DRTF1-polypeptide 1
  • E2F-related transcription factor
  • transcription factor Dp-1

Background

This gene encodes a member of a family of transcription factors that heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. The encoded protein functions as part of this complex to control the transcriptional activity of numerous genes involved in cell cycle progression from G1 to S phase. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1, 15, and X.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DP1 Antibody (H00007027-M02) (0)

There are no publications for DP1 Antibody (H00007027-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DP1 Antibody (H00007027-M02) (0)

There are no reviews for DP1 Antibody (H00007027-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DP1 Antibody (H00007027-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DP1 Products

Array H00007027-M02

Research Areas for DP1 Antibody (H00007027-M02)

Find related products by research area.

Blogs on DP1

There are no specific blogs for DP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DP1 Antibody (3E4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TFDP1
Entrez
Uniprot