Dopamine beta-Hydroxylase Antibody


Western Blot: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Analysis in human adrenal gland and testis tissues. Corresponding Dopamine beta-Hydroxylase RNA-seq data are more
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human colon shows moderate cytoplasmic positivity in peripheral ganglion.
Independent Antibodies: Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human adrenal gland, kidney, lower gastrointestinal and testis using Anti-Dopamine more
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human kidney shows very weak positivity in cells in tubules as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Dopamine beta-Hydroxylase Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
Specificity of human Dopamine beta-Hydroxylase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Dopamine beta-Hydroxylase Recombinant Protein Antigen (NBP2-57836PEP)

Reactivity Notes

Mouse 80%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Dopamine beta-Hydroxylase Antibody

  • DBH
  • DBM
  • dopamine beta-hydroxylase (dopamine beta-monooxygenase)
  • Dopamine betaHydroxylase
  • Dopamine beta-Hydroxylase
  • Dopamine beta-monooxygenase
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
Species: Hu, Rt
Applications: WB
Species: Hu
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Dopamine beta-Hydroxylase Antibody (NBP2-57836) (0)

There are no publications for Dopamine beta-Hydroxylase Antibody (NBP2-57836).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dopamine beta-Hydroxylase Antibody (NBP2-57836) (0)

There are no reviews for Dopamine beta-Hydroxylase Antibody (NBP2-57836). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dopamine beta-Hydroxylase Antibody (NBP2-57836) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Dopamine beta-Hydroxylase Products

Bioinformatics Tool for Dopamine beta-Hydroxylase Antibody (NBP2-57836)

Discover related pathways, diseases and genes to Dopamine beta-Hydroxylase Antibody (NBP2-57836). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dopamine beta-Hydroxylase Antibody (NBP2-57836)

Discover more about diseases related to Dopamine beta-Hydroxylase Antibody (NBP2-57836).

Pathways for Dopamine beta-Hydroxylase Antibody (NBP2-57836)

View related products by pathway.

PTMs for Dopamine beta-Hydroxylase Antibody (NBP2-57836)

Learn more about PTMs related to Dopamine beta-Hydroxylase Antibody (NBP2-57836).

Research Areas for Dopamine beta-Hydroxylase Antibody (NBP2-57836)

Find related products by research area.

Blogs on Dopamine beta-Hydroxylase

There are no specific blogs for Dopamine beta-Hydroxylase, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Dopamine beta-Hydroxylase Antibody and receive a gift card or discount.


Gene Symbol DBH