The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to DDC (dopa decarboxylase, aromatic L-amino acid decarboxylase). The peptide sequence was selected from the N terminal of DDC (NP_000781). Peptide sequence EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE. The peptide sequence for this immunogen was taken from within the described region.
Localization
Cytosol
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-56918 in the following applications:
DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Dopa Decarboxylase/DDC Antibody (NBP1-56918) (0)
There are no reviews for Dopa Decarboxylase/DDC Antibody (NBP1-56918).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Dopa Decarboxylase/DDC Antibody (NBP1-56918). (Showing 1 - 1 of 1 FAQs).
I would like to use your anti-DOPA Decarboxylase Antibody (NBP1-56918) in fixed mouse brain sections (IHC) and was wondering if it has been evaluated for this particular use? Do you also offer the DOPA Decarboxylase Peptide?
In our validation studies, NBP1-56918 was tested with human kidney tissue in IHC-P application wherein this antibody showed nice staining at the antibody concentration range of 4-8ug/ml. Unfortunately, I do not have any data to provide on the mouse brain's IHC-P staining specifically at the moment, however, you should not be concerned because the immunogen sequence is 100% identical to mouse and we have validated this product successfully in IHC-P. We are always there to help in case you face any trouble in generating your desired outcome out of the use of our products. We do sell Blocking Peptide specific for DOPA Decarboxylase Antibody (NBP1-56918) and the catalog # for the peptide is NBP1-56918PEP.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Dopa Decarboxylase/DDC Antibody - BSA Free and receive a gift card or discount.