DOK7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DOK7 Antibody [NBP2-32465] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DOK7 Antibody [NBP2-32465] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DOK7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SSLDVWRATDELGSLLSLPAAGAPEPSLCTCLPGTVEYQVPTSLRAHYDTPRSLCLAPRDHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOK7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DOK7 Protein (NBP2-32465PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DOK7 Antibody

  • C4orf25
  • C4orf25chromosome 4 open reading frame 25
  • CMS1B
  • docking protein 7
  • DOK7
  • Dok-7
  • Downstream of tyrosine kinase 7
  • FLJ33718
  • FLJ39137
  • FLJ90556
  • protein Dok-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-85537
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5948
Species: Hu, Rt
Applications: WB, IHC
NBP2-14915
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57262
Species: Hu
Applications: ICC/IF
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF562
Species: Rt
Applications: WB, Neut
H00006329-R01
Species: Hu
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-79952
Species: Hu
Applications: WB
NB120-2804
Species: Hu, Mu, Rt, Am, Ch, Fi
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84478
Species: Hu
Applications: WB, IHC, IHC-P
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NBP2-32465
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DOK7 Antibody (NBP2-32465) (0)

There are no publications for DOK7 Antibody (NBP2-32465).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOK7 Antibody (NBP2-32465) (0)

There are no reviews for DOK7 Antibody (NBP2-32465). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DOK7 Antibody (NBP2-32465) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOK7 Products

Bioinformatics Tool for DOK7 Antibody (NBP2-32465)

Discover related pathways, diseases and genes to DOK7 Antibody (NBP2-32465). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOK7 Antibody (NBP2-32465)

Discover more about diseases related to DOK7 Antibody (NBP2-32465).
 

Pathways for DOK7 Antibody (NBP2-32465)

View related products by pathway.

PTMs for DOK7 Antibody (NBP2-32465)

Learn more about PTMs related to DOK7 Antibody (NBP2-32465).

Blogs on DOK7

There are no specific blogs for DOK7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOK7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOK7
Entrez