DNCIC1 Recombinant Protein Antigen

Images

 
There are currently no images for DNCIC1 Protein (NBP2-38933PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNCIC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DYNC1I1.

Source: E. coli

Amino Acid Sequence: LQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DYNC1I1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38933.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNCIC1 Recombinant Protein Antigen

  • cytoplasmic dynein 1 intermediate chain 1
  • Cytoplasmic dynein intermediate chain 1
  • DNCI1cytoplasmic, intermediate polypeptide 1
  • DNCIC1DH IC-1
  • Dynein intermediate chain 1, cytosolic
  • dynein, cytoplasmic 1, intermediate chain 1

Background

Eukaryotic cells rely on actin and microtubule-based protein "motors" to generate intracellular movements.4 These protein "motors" contain specialized domains that hydrolyse ATP to produce force and movement along a cytoskeletal polymer (actin in the case of myosin family and microtubules in the case of the kinesin family and dyneins). The minus-end-directed, microtubule motor, dynein ATPase is one of the most widely studied microtubule-associated energy transducing enzymes. It constitutes the outer and inner arms on the doublet tubules of sperm flagellar axonemes, where it generates the sliding between doublets that underlies flagellar beating. Dynein has also been implicated in cytoplasmic motile functions, including chromosomal movement, retrograde organelle and axonal transport, the endocytic pathway, and the organization of the Golgi apparatus. In all cell types, dynein has the same basic structures and is composed of two or three distinct heavy chains (approximately 450 kDa), three intermediate chains (70-125 kDa), and at least four light chains (15-25 kDa).5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38469
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
7268-CT
Species: Hu
Applications: BA
NB100-1110
Species: Hu, Rb
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, PLA, WB
AF1183
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, Neut, WB
NBP2-14935
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-38234
Species: Hu
Applications: IHC,  IHC-P
NBP1-89714
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP1-80886
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-33380
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-45844
Species: Hu
Applications: IHC,  IHC-P, WB
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-76802
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO
NBP2-67796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
291-G1
Species: Hu
Applications: BA
AF5769
Species: Hu
Applications: IHC, WB
AF5110
Species: Mu
Applications: IHC, WB
NBP2-38933PEP
Species: Hu
Applications: AC

Publications for DNCIC1 Protein (NBP2-38933PEP) (0)

There are no publications for DNCIC1 Protein (NBP2-38933PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNCIC1 Protein (NBP2-38933PEP) (0)

There are no reviews for DNCIC1 Protein (NBP2-38933PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNCIC1 Protein (NBP2-38933PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNCIC1 Products

Research Areas for DNCIC1 Protein (NBP2-38933PEP)

Find related products by research area.

Blogs on DNCIC1

There are no specific blogs for DNCIC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNCIC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DYNC1I1