DNAM-1/CD226 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DNAM-1/CD226 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAM-1/CD226
  
  

  Source: E.coli

  Amino Acid Sequence: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CD226
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21236. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNAM-1/CD226 Recombinant Protein Antigen

• CD226 antigenplatelet and T cell activation antigen 1
• CD226 molecule
• CD226
• DNAM1
• DNAM-1
• DNAM1adhesion glycoprotein
• DNAM-1DNAX accessory molecule-1
• DNAX accessory molecule 1
• PTA1
• T lineage-specific activation antigen 1 antigen
• TLiSA1

Background

CD226 is a 65kD type I transmembrane glycoprotein, known as DNAM-1 (DNAX accessory molecule-1), PTA1(platelet and T cell activation antigen 1), or TLiSA1 (T lineage-specific activation antigen 1 antigen). It belongs to immunoglobulin superfamily containing 2 Ig-like domains, is expressed on majority of T lymphocytes, NK cells, monocytes, platelets, and a subset of B cells, activated endothelial cells. DNAM-1 is also expressed on CD8+ (but not CD8-) dendritic cells in mouse model. CD226 is an adhesion molecule involved in CTL and NK cell-mediated cytotoxicity. It has been identified that CD155 (poliovirus receptor, PVR) and CD112 (nectin-2, PRR-2) are CD226 ligands. DX11 antibody is able to inhibit CTL and NK cell-mediated cytotoxicity, and to block T cell cytokine production.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CD226