DNAM-1/CD226 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAM-1/CD226 Source: E.coli
Amino Acid Sequence: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CD226 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21236. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for DNAM-1/CD226 Recombinant Protein Antigen
Background
CD226 is a 65kD type I transmembrane glycoprotein, known as DNAM-1 (DNAX accessory molecule-1), PTA1(platelet and T cell activation antigen 1), or TLiSA1 (T lineage-specific activation antigen 1 antigen). It belongs to immunoglobulin superfamily containing 2 Ig-like domains, is expressed on majority of T lymphocytes, NK cells, monocytes, platelets, and a subset of B cells, activated endothelial cells. DNAM-1 is also expressed on CD8+ (but not CD8-) dendritic cells in mouse model. CD226 is an adhesion molecule involved in CTL and NK cell-mediated cytotoxicity. It has been identified that CD155 (poliovirus receptor, PVR) and CD112 (nectin-2, PRR-2) are CD226 ligands. DX11 antibody is able to inhibit CTL and NK cell-mediated cytotoxicity, and to block T cell cytokine production.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: BA
Species: Mu
Applications: AgAct, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Bind
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: Bind
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
Publications for DNAM-1/CD226 Recombinant Protein Antigen (NBP3-21236PEP) (0)
There are no publications for DNAM-1/CD226 Recombinant Protein Antigen (NBP3-21236PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNAM-1/CD226 Recombinant Protein Antigen (NBP3-21236PEP) (0)
There are no reviews for DNAM-1/CD226 Recombinant Protein Antigen (NBP3-21236PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for DNAM-1/CD226 Recombinant Protein Antigen (NBP3-21236PEP) (0)
Additional DNAM-1/CD226 Products
Research Areas for DNAM-1/CD226 Recombinant Protein Antigen (NBP3-21236PEP)
Find related products by research area.
|
Blogs on DNAM-1/CD226