DNAM-1/CD226 Recombinant Protein Antigen

Images

 
There are currently no images for DNAM-1/CD226 Recombinant Protein Antigen (NBP2-68690PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNAM-1/CD226 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAM-1/CD226.

Source: E. coli

Amino Acid Sequence: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD226
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68690.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNAM-1/CD226 Recombinant Protein Antigen

  • CD226 antigenplatelet and T cell activation antigen 1
  • CD226 molecule
  • CD226
  • DNAM1
  • DNAM-1
  • DNAM1adhesion glycoprotein
  • DNAM-1DNAX accessory molecule-1
  • DNAX accessory molecule 1
  • PTA1
  • T lineage-specific activation antigen 1 antigen
  • TLiSA1

Background

CD226 is a 65kD type I transmembrane glycoprotein, known as DNAM-1 (DNAX accessory molecule-1), PTA1(platelet and T cell activation antigen 1), or TLiSA1 (T lineage-specific activation antigen 1 antigen). It belongs to immunoglobulin superfamily containing 2 Ig-like domains, is expressed on majority of T lymphocytes, NK cells, monocytes, platelets, and a subset of B cells, activated endothelial cells. DNAM-1 is also expressed on CD8+ (but not CD8-) dendritic cells in mouse model. CD226 is an adhesion molecule involved in CTL and NK cell-mediated cytotoxicity. It has been identified that CD155 (poliovirus receptor, PVR) and CD112 (nectin-2, PRR-2) are CD226 ligands. DX11 antibody is able to inhibit CTL and NK cell-mediated cytotoxicity, and to block T cell cytokine production.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
AF2229
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF1730
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
7268-CT
Species: Hu
Applications: BA
AF2225
Species: Mu
Applications: AgAct, CyTOF-ready, Flow, IHC, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
202-IL
Species: Hu
Applications: BA
1849-NK
Species: Hu
Applications: BA
MAB3595
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF629
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
AF1597
Species: Hu
Applications: Block, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
4325-FC
Species: Hu
Applications: Bind
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
NBP2-68690PEP
Species: Hu
Applications: AC

Publications for DNAM-1/CD226 Recombinant Protein Antigen (NBP2-68690PEP) (0)

There are no publications for DNAM-1/CD226 Recombinant Protein Antigen (NBP2-68690PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAM-1/CD226 Recombinant Protein Antigen (NBP2-68690PEP) (0)

There are no reviews for DNAM-1/CD226 Recombinant Protein Antigen (NBP2-68690PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNAM-1/CD226 Recombinant Protein Antigen (NBP2-68690PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNAM-1/CD226 Products

Research Areas for DNAM-1/CD226 Recombinant Protein Antigen (NBP2-68690PEP)

Find related products by research area.

Blogs on DNAM-1/CD226

There are no specific blogs for DNAM-1/CD226, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNAM-1/CD226 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD226