DNAJC15 Antibody (7D7X7)

Western Blot: DNAJC15 Antibody (7D7X7) [NBP3-16488] - Analysis of extracts of various cell lines, using DNAJC15 Rabbit mAb (NBP3-16488) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: DNAJC15 Antibody (7D7X7) [NBP3-16488] - Immunofluorescence analysis of NIH-3T3 cells using DNAJC15 Rabbit mAb (NBP3-16488) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 7D7X7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

DNAJC15 Antibody (7D7X7) Summary

• Description: Novus Biologicals Rabbit DNAJC15 Antibody (7D7X7) (NBP3-16488) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human DNAJC15 (Q9Y5T4). ETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DNAJC15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DNAJC15 Antibody (7D7X7)

• Cell growth-inhibiting gene 22 protein
• DnaJ (Hsp40) homolog, subfamily C, member 15
• DnaJ (Hsp40) homolog, subfamily D, member 1
• DNAJ domain-containing
• dnaJ homolog subfamily C member 15
• DNAJD1
• MCJHSD18
• Methylation-controlled J protein

Background

DNAJD1( AAH10910, 1 a.a. - 151 a.a.) full-length recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC15