DNAJB12 Antibody - BSA Free

Western Blot: DNAJB12 Antibody [NBP1-59444] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: DNAJB12 Antibody [NBP1-59444] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DNAJB12 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to DNAJB12(DnaJ (Hsp40) homolog, subfamily B, member 12) The peptide sequence was selected from the middle region of DNAJB12. Peptide sequence ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJB12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DNAJB12 Antibody - BSA Free

• DJ10FLJ20027
• DKFZp586B2023
• DnaJ (Hsp40) homolog, subfamily B, member 12
• dnaJ homolog subfamily B member 12
• FLJ0027

Background

DNAJB12, also known as DnaJ homolog subfamily B member 12, consists of a 41.8 kDa and a 42.3 kDa isoform and is involved in stimulating ATPase in order to regulate molecular chaperone activity as a part of the DNAJ/HSP40 family. Diseases and disorders such as malaria, fundus dystrophy, choroiditis, choroideremia, and cone-rod dystrophy have been studied with the protein. The protein acts in the protein processing pathway in the endoplasmic reticulum along with MME, MYC, HSPA2, TNFRSF1A, and WIPI2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJB12
• Uniprot:
  • Q9NXW2(Human)