DNAJB11 Antibody - BSA Free

Western Blot: DNAJB11 Antibody [NBP1-84900] - Analysis in control (vector only transfected HEK293T lysate) and DNAJB11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: DNAJB11 Antibody [NBP1-84900] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.

Western Blot: DNAJB11 Antibody [NBP1-84900] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: DNAJB11 Antibody [NBP1-84900] - Staining of human placenta shows strong cytoplasmic positivity in Syncytiotrophoblasts.

Immunohistochemistry-Paraffin: DNAJB11 Antibody [NBP1-84900] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: DNAJB11 Antibody [NBP1-84900] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DNAJB11 Antibody [NBP1-84900] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNAJB11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNAJB11 Antibody - BSA Free (NBP1-84900) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
• Predicted Species: Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJB11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DNAJB11 Protein (NBP1-84900PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNAJB11 Antibody - BSA Free

• ABBP-2
• APOBEC1-binding protein 2
• DnaJ (Hsp40) homolog, subfamily B, member 11
• dnaJ homolog subfamily B member 11
• DnaJ protein homolog 9
• EDJABBP2
• ER-associated dnaJ protein 3
• ER-associated DNAJ
• ER-associated Hsp40 co-chaperone
• ERdj3DJ9
• ERJ3
• ERj3p
• hDj9
• hDj-9
• HEDJERj3
• Human DnaJ protein 9
• PRO1080
• PWP1-interacting protein 4
• UNQ537

Background

Members of the heat shock protein 40 (HSP 40) family of proteins all contain a highly conserved J domain that associates with HSP 70 and regulates the function of HSP 70 by activating its adenosine triphosphatase activity. ERdj3, an HSP 40 chaperone, is expressed in the ER lumen, where it interacts with BiP, a molecule involved in retrotranslocating proteins out of the ER. ERdj3 also associates with several other protein substrates, including unfolded light chains, a nonsecreted Ig light chain mutant and a VSV-G ts045 mutant. Shiga toxin (Stx) is a bacterial tool that enzymatically inactivates the 28S rRNA, inhibiting protein synthesis of infected cells. Stx also interacts with ERdj3 and Sec 61 to form a complex through which proteins are retrotranslocated to the cytoplasm. ERdj3 may play a role in the ER quality control system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJB11