Home » Carboxylesterase 2/CES2 » Carboxylesterase 2/CES2 Antibodies » Carboxylesterase 2/CES2 Antibody

Carboxylesterase 2/CES2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CES2 Antibody [NBP1-84556] - Analysis in human small intestine tissue.
Western Blot: CES2 Antibody [NBP1-84556] - Analysis in human small intestine tissue.
Immunocytochemistry/ Immunofluorescence: CES2 Antibody [NBP1-84556] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Carboxylesterase 2/CES2 Antibody [NBP1-84556] - CES2 Antibody [NBP1-84556] - Staining in human small intestine and pancreas tissues using anti-CES2 antibody. ...read more
Immunohistochemistry-Paraffin: CES2 Antibody [NBP1-84556] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CES2 Antibody [NBP1-84556] - Staining of human small intestine shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Carboxylesterase 2/CES2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQP
Specificity
Specificity of human CES2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CES2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Carboxylesterase 2/CES2 Recombinant Protein Antigen (NBP1-84556PEP)
Publications
Read Publication using NBP1-84556.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carboxylesterase 2/CES2 Antibody

  • carboxylesterase 2 (intestine, liver)
  • Carboxylesterase 2
  • carboxylesterase 2EC 3.1.1.1
  • CE-2
  • CE-2PCE-2
  • CES2
  • CES2A1
  • EC 3.1.1
  • EC 3.1.1.84
  • hCE-2
  • iCE
  • intestinal carboxylesterase; liver carboxylesterase-2
  • PCE-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of Caspase-3 Antibody (31A1067) - (Pro and Active). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.
Simple Western: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Simple Western lane view shows a specific band for Caspase-3 Antibody (31A1067) - (Pro and Active) in 0.1 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230kDa separation system.
(1 Review)
(153 Publications)
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(31 Reviews)
(645 Publications)
Species: Hu
Caspase-1 Antibody
(14F468)
NB100-56565
Simple Western: Caspase-1 Antibody (14F468) [NB100-56565] - Simple Western lane view shows a specific band for Caspase 1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - P. gingivalis and its OMVs differentially induce inflammasome signaling and pyroptosis in murine macrophages. BMM were infected as before (2 h at MOI of 25:1, see Materials and Methods) with viable P. gingivalis (Pg), heat-killed-Pg (HK-Pg), OMVs, or heat-inactivated-OMVs (HI-OMVs) and the activation of inflammasome components in the lysates [or supernatants (sup) where indicated] measured after 24 h by Western blot; beta-actin serves as a loading control throughout. Western blot data are representative of at least three independent experiments. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fcimb.2017.00351/full), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - Detection of Caspase-1 protein in a section of normal human colon using 5 ug/ml concentration of Caspase 1 antibody (clone 14F468). Distinct cytoplasmic staining along with some nuclear positivity was observed in crypts/mucosa, and staining was found to be more intense in the absorptive columnar epithelial cells. [10X Magnification]
(45 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(18 Reviews)
(401 Publications)
Species: Hu
Fas/TNFRSF6/CD95
[HRP]
DFS00
(17 Publications)
Species: Hu
IL-18/IL-1F4 [HRP]
7620
IL-18/IL-1F4 [HRP]
(39 Publications)
Species: Hu
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - Analysis of a FFPE human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(9 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Carboxylesterase
1/CES1 Antibody
NBP1-85691
Western Blot: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human kidney using Anti-CES1 antibody NBP1-85691.
Immunohistochemistry-Paraffin: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Staining of human kidney shows low expression as expected.
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Methionyl tRNA
synthetase Antibody
NBP1-87730
Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MARS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of mouse pons shows neuronal positivity in motor trigeminal nucleus.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
SLA2 Antibody
(OTI3A7) - Azide and ...
NBP2-74210
Western Blot: SLA2 Antibody (OTI3A7) - Azide and BSA Free [NBP2-74210] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SLA2.
Immunohistochemistry: SLA2 Antibody (OTI3A7) - Azide and BSA Free [NBP2-74210] - Analysis of Human pancreas tissue.
Flow Cytometry: SLA2 Antibody (OTI3A7) - Azide and BSA Free [NBP2-74210] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by SLA2 antibody.
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
PARP Antibody
(194C1439) - Cleaved
NB100-56599
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, antibody at 2 ug/mL. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.
Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - Cleaved [NB100-56599] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis using 293T lysates expressing PARP. Image from verified customer review.
(7 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for alpha ‑Fetoprotein/AFP at approximately 70 kDa (as indicated) using 5 µg/mL of Mouse Anti-Human/Mouse alpha ‑Fetoprotein/AFP Monoclonal Antibody (Catalog # MAB1368). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HepG2 human hepatocellular carcinoma parental cell line and alpha ‑Fetoprotein/AFP knockout HepG2 cell line (KO). PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human/Mouse alpha ‑Fetoprotein/AFP Monoclonal Antibody (Catalog # MAB1368) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for alpha ‑Fetoprotein/AFP at approximately 70 kDa (as indicated) in the parental HeLacell line, but is not detectable in knockout HeLa cell line. GAPDH(Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
alpha -Fetoprotein/AFP knockout HepG2 hepatocellular carcinoma cell line was stained with Mouse Anti-Human alpha -Fetoprotein/AFP Monoclonal Antibody (Catalog # MAB1368, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram) followed by PE-conjugated Goat anti-Mouse IgG Secondary Antibody (Catalog # F0102B). No staining in the alpha -Fetoprotein/AFP knockout HepG2 cell line was observed. View our protocol for Staining Membrane-associated Proteins.
(7 Reviews)
(36 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
TRIM26 Antibody
NBP2-47594
Immunocytochemistry/Immunofluorescence: TRIM26 Antibody [NBP2-47594] - Staining human cell line A-431 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: TRIM26 Antibody [NBP2-47594] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center and non-germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Bcl-xL Antibody
NB100-56104
Western Blot: Bcl-xL Antibody [NB100-56104] - WB analysis of tissue lysates from breast surgical tumor tissue biopsies (Lanes 1-7). Bcl-XS is not detected and variable amounts of Bcl-XL (~30 kDa) is detected. Lane 8. Recombinant Bcl-XL (positive control).
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in Daoy whole cell lysate using anti-Bcl-xL antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Bcl-xL Antibody [NB100-56104] - Formalin-fixed paraffin-embedded sections of human epidermis stained for Bcl-xL expression. The bottom image was negative for Bcl-xL expression. The adjacent stratum spinosum and middle stratum granulosum layers were both very positive for Bcl-xL expression. The top stratum corneum consisting mainly of dead or peeling cells were both negative for Bcl-xL expression.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Metallothionein-2A
Antibody (6G2)
H00004502-M01
Immunocytochemistry/Immunofluorescence: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Analysis of monoclonal antibody to MT2A on HeLa cell. Antibody concentration 10 ug/ml.
ELISA: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Detection limit for recombinant GST tagged MT2A is 0.3 ng/ml as a capture antibody.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, S-ELISA
Caspase-8 Antibody
- (active/cleaved)
NB100-56116
Immunohistochemistry: Caspase-8 Antibody - (active/cleaved) [NB100-56116] - Autophagy-deficient mice showed increased activity of apoptosis and necroptosis. Reduced pancreatic Atg7 level increased the expression of Caspase-8 in 12-week-old Atg7deltapan mice. Caspase-8 quantitation and representative IF microphotographs of Atg7F/F (n=5) and Atg7deltapan (n=5) pancreatic tissue stained for DAPI (blue) and Caspase-8 (green) ( 1/1000, scale bar=50 um). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/cddis.2017.313), licensed under a CC-BY licence.
Western Blot: Caspase-8 Antibody - (active/cleaved) [NB100-56116] - Analysis of active/cleaved Caspase 8 in NRK whole cell lysate using anti-active/cleaved Caspase 8 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Caspase-8 Antibody - (active/cleaved) [NB100-56116] - Sections from a brain tumor tissue array stained for Caspase-8 expression using NB100-56116 at 1:2000. A. Anaplastic glioma (Grade III, left) and Gemistocytoma (Grade II, right) cores showing negative and positive staining for Caspase-8, respectively. B. Higher magnification of the Gemistocytoma tumor (from A).
(1 Review)
(55 Publications)
Species: Hu, Mu, Rt, Ma
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Carboxylesterase 2/CES2 Antibody (NBP1-84556)(1)


Reviews for Carboxylesterase 2/CES2 Antibody (NBP1-84556) (0)

There are no reviews for Carboxylesterase 2/CES2 Antibody (NBP1-84556). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Carboxylesterase 2/CES2 Antibody (NBP1-84556) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Carboxylesterase 2/CES2 Products

Bioinformatics Tool for Carboxylesterase 2/CES2 Antibody (NBP1-84556)

Discover related pathways, diseases and genes to Carboxylesterase 2/CES2 Antibody (NBP1-84556). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxylesterase 2/CES2 Antibody (NBP1-84556)

Discover more about diseases related to Carboxylesterase 2/CES2 Antibody (NBP1-84556).
 

Pathways for Carboxylesterase 2/CES2 Antibody (NBP1-84556)

View related products by pathway.

PTMs for Carboxylesterase 2/CES2 Antibody (NBP1-84556)

Learn more about PTMs related to Carboxylesterase 2/CES2 Antibody (NBP1-84556).

Blogs on Carboxylesterase 2/CES2

There are no specific blogs for Carboxylesterase 2/CES2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carboxylesterase 2/CES2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CES2