Home » Carboxylesterase 2/CES2 » Carboxylesterase 2/CES2 Antibodies » Carboxylesterase 2/CES2 Antibody

Carboxylesterase 2/CES2 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CES2 Antibody [NBP1-84556] - Analysis in human small intestine tissue.
Western Blot: CES2 Antibody [NBP1-84556] - Analysis in human small intestine tissue.
Immunocytochemistry/ Immunofluorescence: CES2 Antibody [NBP1-84556] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Carboxylesterase 2/CES2 Antibody [NBP1-84556] - CES2 Antibody [NBP1-84556] - Staining in human small intestine and pancreas tissues using anti-CES2 antibody. ...read more
Immunohistochemistry-Paraffin: CES2 Antibody [NBP1-84556] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CES2 Antibody [NBP1-84556] - Staining of human small intestine shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Carboxylesterase 2/CES2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CES2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Carboxylesterase 2/CES2 Recombinant Protein Antigen (NBP1-84556PEP)
Publications
Read Publication using NBP1-84556.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carboxylesterase 2/CES2 Antibody

  • carboxylesterase 2 (intestine, liver)
  • Carboxylesterase 2
  • carboxylesterase 2EC 3.1.1.1
  • CE-2
  • CE-2PCE-2
  • CES2
  • CES2A1
  • EC 3.1.1
  • EC 3.1.1.84
  • hCE-2
  • iCE
  • intestinal carboxylesterase; liver carboxylesterase-2
  • PCE-2

Background

Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase‑3 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Rabbit Anti-Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Caspase‑3 was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(200 Publications)
Species: Hu, Mu
Applications: ICC, IHC
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(739 Publications)
Species: Hu
Applications: BA
Caspase-1 Antibody
(14F468) - BSA Free
NB100-56565
Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - Tissue section of human intestine using Caspase-1 antibody (clone 14F468) at 5ug/ml concentration (1:200 dilution). The primary antibody binding to Caspase 1 in cells was detected using HRP conjugated anti-Mouse secondary antibody with DAB reagent, and the sections were further counterstained with hematoxylin for labeling cellular nuclei. This Caspase 1 antibody generated a diffused but specific cytoplasmic staining in columnar epithelia cells of villi, and a few cells depicted nuclear staining also. Only a subset of connective tissue cells in lamina propria depicted positivity (cytoplasmic) for this protein.
Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - P. gingivalis and its OMVs differentially induce inflammasome signaling and pyroptosis in murine macrophages. BMM were infected as before (2 h at MOI of 25:1, see Materials and Methods) with viable P. gingivalis (Pg), heat-killed-Pg (HK-Pg), OMVs, or heat-inactivated-OMVs (HI-OMVs) and the activation of inflammasome components in the lysates [or supernatants (sup) where indicated] measured after 24 h by Western blot; beta-actin serves as a loading control throughout. Western blot data are representative of at least three independent experiments. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fcimb.2017.00351/full), licensed under a CC-BY licence.
Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - LukAB is a potent activator of Caspase 1. THP1 cells were intoxicated with 50 ng/mL LukAB for 1 hour and cell lysates were analyzed by immunoblot for Caspase 1 cleavage, which indicates activation. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.ppat.1004970) licensed under a CC-BY licence.
(61 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
IL-1 beta/IL-1F2
[Unconjugated]
201-LB/CF
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB/CF) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(523 Publications)
Species: Hu
Applications: BA
Fas/TNFRSF6/CD95
[HRP]
DFS00
(17 Publications)
Species: Hu
Applications: ELISA
IL-18/IL-1F4 [HRP]
7625
IL-18/IL-1F4 [HRP]
(53 Publications)
Species: Mu
Applications: ELISA
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 using this antibody at 1:2000, 20 ug/protein was loaded per lane. (1) Human Jurkat T cells. (2) Human RS11 lymphoma cells. (3-6) Human breast cancer cases. Patient sample in lane 5 lacked detectible Bcl-2 expression.
(2 Reviews)
(16 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Carboxylesterase
1/CES1 Antibody
NBP1-85691
Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Simple Western lane view shows a specific band for CES1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Electropherogram image(s) of corresponding Simple Western lane view. CES1 antibody was used at 1:20 dilution on RT-4 lysate(s).
Western Blot: Carboxylesterase 1/CES1 Antibody [NBP1-85691] - Analysis in human cell line HepG2.
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Methionyl tRNA
synthetase Antibody
NBP1-87730
Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase Antibody [NBP1-87730] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Western Blot: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-MARS antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: Methionyl tRNA synthetase Antibody [NBP1-87730] - Analysis in human testis and skeletal muscle tissues using NBP1-87730 antibody. Corresponding Methionyl tRNA synthetase RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
SLA2 Antibody
(OTI3A7) - Azide and ...
NBP2-74210
Western Blot: SLA2 Antibody (OTI3A7) - Azide and BSA Free [NBP2-74210] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SLA2.
Flow Cytometry: SLA2 Antibody (OTI3A7) - Azide and BSA Free [NBP2-74210] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by SLA2 antibody.
Immunohistochemistry: SLA2 Antibody (OTI3A7) - Azide and BSA Free [NBP2-74210] - Analysis of Adenocarcinoma of Human breast tissue.
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-P, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - Analysis using 293T lysates expressing PARP. Image from verified customer review.
Western Blot: PARP Antibody (194C1439) - (Azide Free), Cleaved [NBP2-27335] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, using this antibody. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western lane view shows lysates of HepG2 human hepatocellular carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for alpha ‑Fetoprotein/AFP at approximately 70 kDa (as indicated) using 5 µg/mL of Mouse Anti-Human/Mouse alpha ‑Fetoprotein/AFP Monoclonal Antibody (Catalog # MAB1368). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HepG2 human hepatocellular carcinoma parental cell line and alpha ‑Fetoprotein/AFP knockout HepG2 cell line (KO). PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human/Mouse alpha ‑Fetoprotein/AFP Monoclonal Antibody (Catalog # MAB1368) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for alpha ‑Fetoprotein/AFP at approximately 70 kDa (as indicated) in the parental HeLacell line, but is not detectable in knockout HeLa cell line. GAPDH(Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
alpha -Fetoprotein/AFP knockout HepG2 hepatocellular carcinoma cell line was stained with Mouse Anti-Human alpha -Fetoprotein/AFP Monoclonal Antibody (Catalog # MAB1368, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram) followed by PE-conjugated Goat anti-Mouse IgG Secondary Antibody (Catalog # F0102B). No staining in the alpha -Fetoprotein/AFP knockout HepG2 cell line was observed. View our protocol for Staining Membrane-associated Proteins.
(3 Reviews)
(55 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
TRIM26 Antibody
NBP2-47594
Immunocytochemistry/Immunofluorescence: TRIM26 Antibody [NBP2-47594] - Staining human cell line A-431 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: TRIM26 Antibody [NBP2-47594] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center and non-germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Bcl-xL Antibody
NB100-56104
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in Daoy whole cell lysate using anti-Bcl-xL antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in human breast carcinoma at 1:2000. Formalin-fixed, paraffin-embedded tissue section from invasive ductal carcinoma. An organellar/mitochondrial pattern of Bcl-xL staining is observed in the cytosol of tumor cells.
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in lysates from isolated rat liver mitochondria using this antibody. The antibody detected Bcl-xL at ~30 kDa.
(1 Review)
(2 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Metallothionein-2A
Antibody (6G2)
H00004502-M01
ELISA: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Detection limit for recombinant GST tagged MT2A is 0.3 ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: Metallothionein-2A Antibody (6G2) [H00004502-M01] - Analysis of monoclonal antibody to MT2A on HeLa cell . Antibody concentration 10 ug/ml.
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Caspase-8 Antibody
NB100-56116
Western Blot: Caspase-8 Antibody - (active/cleaved) [NB100-56116] - Analysis of active/cleaved Caspase 8 in NRK whole cell lysate using anti-active/cleaved Caspase 8 antibody. WB image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Caspase-8 Antibody - (active/cleaved) [NB100-56116] - Sections from a brain tumor tissue array stained for Caspase-8 expression using NB100-56116 at 1:2000. A. Anaplastic glioma (Grade III, left) and Gemistocytoma (Grade II, right) cores showing negative and positive staining for Caspase-8, respectively. B. Higher magnification of the Gemistocytoma tumor (from A).
Immunohistochemistry-Paraffin: Caspase-8 Antibody - (active/cleaved) [NB100-56116] - Sections from a brain tissue array stained for Caspase-8 expression using NB100-56116 at 1:2000. A. Normal brain stem (1) and cortex (2). B. Higher magnification of cortex (from A). C. Higher magnification of brain stem (from A). D. Normal cerebellum showing caspase-8 staining in the Purkinge cells.
(2 Reviews)
(65 Publications)
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for Carboxylesterase 2/CES2 Antibody (NBP1-84556)(1)


Reviews for Carboxylesterase 2/CES2 Antibody (NBP1-84556) (0)

There are no reviews for Carboxylesterase 2/CES2 Antibody (NBP1-84556). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Carboxylesterase 2/CES2 Antibody (NBP1-84556) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carboxylesterase 2/CES2 Products

Bioinformatics Tool for Carboxylesterase 2/CES2 Antibody (NBP1-84556)

Discover related pathways, diseases and genes to Carboxylesterase 2/CES2 Antibody (NBP1-84556). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxylesterase 2/CES2 Antibody (NBP1-84556)

Discover more about diseases related to Carboxylesterase 2/CES2 Antibody (NBP1-84556).
 

Pathways for Carboxylesterase 2/CES2 Antibody (NBP1-84556)

View related products by pathway.

PTMs for Carboxylesterase 2/CES2 Antibody (NBP1-84556)

Learn more about PTMs related to Carboxylesterase 2/CES2 Antibody (NBP1-84556).
 

Research Areas for Carboxylesterase 2/CES2 Antibody (NBP1-84556)

Find related products by research area.

Blogs on Carboxylesterase 2/CES2

There are no specific blogs for Carboxylesterase 2/CES2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carboxylesterase 2/CES2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol CES2