Carboxylesterase 2/CES2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CES2 Antibody [NBP1-84556] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: Carboxylesterase 2/CES2 Antibody [NBP1-84556] - CES2 Antibody [NBP1-84556] - Staining in human small intestine and pancreas tissues using anti-CES2 antibody. Corresponding CES2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CES2 Antibody [NBP1-84556] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: CES2 Antibody [NBP1-84556] - Staining of human small intestine shows high expression.

Analysis in human small intestine tissue.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Carboxylesterase 2/CES2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CES2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Carboxylesterase 2/CES2 Recombinant Protein Antigen (NBP1-84556PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Carboxylesterase 2/CES2 Antibody - BSA Free

• carboxylesterase 2 (intestine, liver)
• Carboxylesterase 2
• carboxylesterase 2EC 3.1.1.1
• CE-2
• CE-2PCE-2
• CES2
• CES2A1
• EC 3.1.1
• EC 3.1.1.84
• hCE-2
• iCE
• intestinal carboxylesterase; liver carboxylesterase-2
• PCE-2

Background

Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Carboxylesterase 2/CES2 Antibody (NBP1-84556)(1)

Publication using NBP1-84556

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: CES2