DNAAF2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DNAAF2 Antibody [NBP1-84069] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: DNAAF2 Antibody [NBP1-84069] - Staining of human testis shows strong cytoplasmic positivity in leydig cells and subsets of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAAF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAAF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNAAF2 Protein (NBP1-84069PEP)
Publications
Read Publication using NBP1-84069.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23872636)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAAF2 Antibody

  • axonemal
  • dynein, axonemal, assembly factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01936
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-93818
Species: Hu
Applications: IHC, IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13896
Species: Hu
Applications: WB, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-51927
Species: Hu
NBP2-39036
Species: Hu
Applications: IHC, IHC-P
NB110-55244
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-77127
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56928
Species: Hu
Applications: WB, ICC/IF
NBP2-57200
Species: Hu
Applications: ICC/IF
NB100-176
Species: Hu, Pm, Mu(-)
Applications: WB, ICC/IF
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP1-32670
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056949-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84069
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for DNAAF2 Antibody (NBP1-84069)(1)


Reviews for DNAAF2 Antibody (NBP1-84069) (0)

There are no reviews for DNAAF2 Antibody (NBP1-84069). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DNAAF2 Antibody (NBP1-84069) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAAF2 Products

Bioinformatics Tool for DNAAF2 Antibody (NBP1-84069)

Discover related pathways, diseases and genes to DNAAF2 Antibody (NBP1-84069). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAAF2 Antibody (NBP1-84069)

Discover more about diseases related to DNAAF2 Antibody (NBP1-84069).
 

Pathways for DNAAF2 Antibody (NBP1-84069)

View related products by pathway.

Blogs on DNAAF2

There are no specific blogs for DNAAF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAAF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAAF2