CYP4X1 Antibody

Images

 
Western Blot: CYP4X1 Antibody [NBP2-13896] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: CYP4X1 Antibody [NBP2-13896] - Staining of human cervix, uterine shows nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP4X1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYR FQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDE SGSSFSDIDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP4X1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CYP4X1 Protein (NBP2-13896PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYP4X1 Antibody

  • CYPIVX1
  • cytochrome P450 4X1
  • cytochrome P450, family 4, subfamily X, polypeptide 1
  • EC 1.14.14.1
  • MGC40051

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30522
Species: Hu
Applications: IHC, IHC-P
NBP1-85361
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50215
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP2-30043
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-83659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86461
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-39036
Species: Hu
Applications: IHC, IHC-P
NBP2-30566
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56928
Species: Hu
Applications: WB, ICC/IF
NBP2-16064
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CYP4X1 Antibody (NBP2-13896) (0)

There are no publications for CYP4X1 Antibody (NBP2-13896).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP4X1 Antibody (NBP2-13896) (0)

There are no reviews for CYP4X1 Antibody (NBP2-13896). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP4X1 Antibody (NBP2-13896) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP4X1 Products

Bioinformatics Tool for CYP4X1 Antibody (NBP2-13896)

Discover related pathways, diseases and genes to CYP4X1 Antibody (NBP2-13896). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP4X1 Antibody (NBP2-13896)

Discover more about diseases related to CYP4X1 Antibody (NBP2-13896).
 

Pathways for CYP4X1 Antibody (NBP2-13896)

View related products by pathway.

PTMs for CYP4X1 Antibody (NBP2-13896)

Learn more about PTMs related to CYP4X1 Antibody (NBP2-13896).

Blogs on CYP4X1

There are no specific blogs for CYP4X1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP4X1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP4X1