DNAAF2 Antibody

Images

 
Western Blot: DNAAF2 Antibody [NBP1-70428] - Hela cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: DNAAF2 Antibody [NBP1-70428] - Human nasal epithelial cells Primary antibody dilution: 1:500 Secondary antibody: Goat anti-rabbit Alexa Fluor 546 Secondary antibody dilution:1:1000

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAAF2 Antibody Summary

Immunogen
Synthetic peptides corresponding to C14ORF104 The peptide sequence was selected from the N terminal of C14ORF104. Peptide sequence MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAAF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against C14orf104 and was validated on Western blot.
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNAAF2 Antibody

  • axonemal
  • dynein, axonemal, assembly factor 2

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01936
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-93818
Species: Hu
Applications: IHC, IHC-P
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13896
Species: Hu
Applications: WB, IHC, IHC-P
NB100-147
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-51927
Species: Hu
NBP2-39036
Species: Hu
Applications: IHC, IHC-P
NB110-55244
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-77127
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56928
Species: Hu
Applications: WB, ICC/IF
NBP2-57200
Species: Hu
Applications: ICC/IF
NB100-176
Species: Hu, Pm, Mu(-)
Applications: WB, ICC/IF
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
MAB8550
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC, KO
NBP1-32670
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056949-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-70428
Species: Hu
Applications: WB, IHC

Publications for DNAAF2 Antibody (NBP1-70428) (0)

There are no publications for DNAAF2 Antibody (NBP1-70428).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAAF2 Antibody (NBP1-70428) (0)

There are no reviews for DNAAF2 Antibody (NBP1-70428). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNAAF2 Antibody (NBP1-70428) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAAF2 Products

Bioinformatics Tool for DNAAF2 Antibody (NBP1-70428)

Discover related pathways, diseases and genes to DNAAF2 Antibody (NBP1-70428). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAAF2 Antibody (NBP1-70428)

Discover more about diseases related to DNAAF2 Antibody (NBP1-70428).
 

Pathways for DNAAF2 Antibody (NBP1-70428)

View related products by pathway.

Blogs on DNAAF2

There are no specific blogs for DNAAF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAAF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAAF2