DNA2 Antibody

Images

 
Western Blot: DNA2 Antibody [NBP2-84799] - WB Suggested Anti-DNA2L Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DNA2. Peptide sequence: KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DNA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNA2 Antibody

  • DNA replication ATP-dependent helicase-like homolog
  • DNA replication helicase 2 homolog (yeast)
  • DNA2 DNA replication helicase 2-like (yeast)
  • EC 3.6.1
  • EC 3.6.4.12
  • FLJ10063
  • KIAA0083DNA2LDNA2-like helicase
  • MGC133297

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-150
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, WB
NBP2-16391
Species: Hu, Mu
Applications: ICC/IF, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-97931
Species: Mu
Applications: ICC/IF (-), IHC, IHC-P, WB (-)
NB100-214
Species: Hu, Mu
Applications: IP, WB
NBP2-03688
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87691
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-119
Species: Ba, Ch, Fi, Ha, Hu, Mu, Rb
Applications: ICC/IF, IHC-P, IP, In vitro, RIA, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
NBP2-93674
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-471
Species: Hu
Applications: ChIP, ICC/IF, IHC, IP, WB
NBP2-84799
Species: Hu
Applications: WB

Publications for DNA2 Antibody (NBP2-84799) (0)

There are no publications for DNA2 Antibody (NBP2-84799).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA2 Antibody (NBP2-84799) (0)

There are no reviews for DNA2 Antibody (NBP2-84799). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA2 Antibody (NBP2-84799) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA2 Products

Bioinformatics Tool for DNA2 Antibody (NBP2-84799)

Discover related pathways, diseases and genes to DNA2 Antibody (NBP2-84799). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA2 Antibody (NBP2-84799)

Discover more about diseases related to DNA2 Antibody (NBP2-84799).
 

Pathways for DNA2 Antibody (NBP2-84799)

View related products by pathway.

PTMs for DNA2 Antibody (NBP2-84799)

Learn more about PTMs related to DNA2 Antibody (NBP2-84799).

Blogs on DNA2

There are no specific blogs for DNA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNA2