DNA Primase small subunit Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DNA Primase small subunit Antibody [NBP1-90897] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Primase small subunit Antibody [NBP1-90897] - Staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA Primase small subunit Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Primase small subunit Protein (NBP1-90897PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNA Primase small subunit Antibody

  • DNA primase 1
  • DNA primase 49 kDa subunit
  • DNA primase small subunit
  • DNA primase subunit 48
  • EC 2.7.7
  • EC 2.7.7.-
  • MGC12308
  • p49
  • primase p49 subunit
  • primase polypeptide 1, 49kDa
  • primase, DNA, polypeptide 1 (49kDa)

Background

DNA Primase small subunit, also known by its gene name PRIM1, is a heterodimer that is composed of a small and large subunit. PRIM1 is 420 amino acids long and approximately 49kDa. The DNA Primase small subunit synthesizes RNA primers for the Okazaki fragments created during discontinuous DNA replication. Current research surrounding PRIM1 has shown a possible link with carcinomas, malaria, neuronitis, and osteosarcoma. DNA Primase small subunit has also been shown to interact with Histone cluster 1 H4/A, H4/B, H4/C, H4/D and H4/E in pathways such as DNA replication, DNA strand elongation, polymerase switching, and lagging strand synthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DNA Primase small subunit Antibody (NBP1-90897) (0)

There are no publications for DNA Primase small subunit Antibody (NBP1-90897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Primase small subunit Antibody (NBP1-90897) (0)

There are no reviews for DNA Primase small subunit Antibody (NBP1-90897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DNA Primase small subunit Antibody (NBP1-90897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA Primase small subunit Products

Research Areas for DNA Primase small subunit Antibody (NBP1-90897)

Find related products by research area.

Blogs on DNA Primase small subunit

There are no specific blogs for DNA Primase small subunit, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Primase small subunit Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRIM1