DNA Primase small subunit Antibody


Immunocytochemistry/ Immunofluorescence: DNA Primase small subunit Antibody [NBP1-90897] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DNA Primase small subunit Antibody [NBP1-90897] - Staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

DNA Primase small subunit Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG
Specificity of human DNA Primase small subunit antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Primase small subunit Protein (NBP1-90897PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DNA Primase small subunit Antibody

  • DNA primase 1
  • DNA primase 49 kDa subunit
  • DNA primase small subunit
  • DNA primase subunit 48
  • EC 2.7.7
  • EC 2.7.7.-
  • MGC12308
  • p49
  • primase p49 subunit
  • primase polypeptide 1, 49kDa
  • primase, DNA, polypeptide 1 (49kDa)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DNA Primase small subunit Antibody (NBP1-90897) (0)

There are no publications for DNA Primase small subunit Antibody (NBP1-90897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Primase small subunit Antibody (NBP1-90897) (0)

There are no reviews for DNA Primase small subunit Antibody (NBP1-90897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DNA Primase small subunit Antibody (NBP1-90897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DNA Primase small subunit Products

Bioinformatics Tool for DNA Primase small subunit Antibody (NBP1-90897)

Discover related pathways, diseases and genes to DNA Primase small subunit Antibody (NBP1-90897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Primase small subunit Antibody (NBP1-90897)

Discover more about diseases related to DNA Primase small subunit Antibody (NBP1-90897).

Pathways for DNA Primase small subunit Antibody (NBP1-90897)

View related products by pathway.

PTMs for DNA Primase small subunit Antibody (NBP1-90897)

Learn more about PTMs related to DNA Primase small subunit Antibody (NBP1-90897).

Research Areas for DNA Primase small subunit Antibody (NBP1-90897)

Find related products by research area.

Blogs on DNA Primase small subunit

There are no specific blogs for DNA Primase small subunit, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNA Primase small subunit Antibody and receive a gift card or discount.


Gene Symbol PRIM1