DNA Primase small subunit Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit DNA Primase small subunit Antibody - BSA Free (NBP1-90897) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG |
| Predicted Species |
Mouse (98%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PRIM1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DNA Primase small subunit Antibody - BSA Free
Background
DNA Primase small subunit, also known by its gene name PRIM1, is a heterodimer that is composed of a small and large subunit. PRIM1 is 420 amino acids long and approximately 49kDa. The DNA Primase small subunit synthesizes RNA primers for the Okazaki fragments created during discontinuous DNA replication. Current research surrounding PRIM1 has shown a possible link with carcinomas, malaria, neuronitis, and osteosarcoma. DNA Primase small subunit has also been shown to interact with Histone cluster 1 H4/A, H4/B, H4/C, H4/D and H4/E in pathways such as DNA replication, DNA strand elongation, polymerase switching, and lagging strand synthesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu
Applications: ICC/IF
Species: Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for DNA Primase small subunit Antibody (NBP1-90897) (0)
There are no publications for DNA Primase small subunit Antibody (NBP1-90897).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNA Primase small subunit Antibody (NBP1-90897) (0)
There are no reviews for DNA Primase small subunit Antibody (NBP1-90897).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DNA Primase small subunit Antibody (NBP1-90897) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNA Primase small subunit Products
Research Areas for DNA Primase small subunit Antibody (NBP1-90897)
Find related products by research area.
|
Blogs on DNA Primase small subunit