DNA polymerase mu Antibody - BSA Free Summary
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein DNA polymerase mu using the following amino acid sequence: SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
POLM |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DNA polymerase mu Antibody - BSA Free
Background
Seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu
Applications: ICC/IF
Publications for DNA polymerase mu Antibody (NBP3-24794) (0)
There are no publications for DNA polymerase mu Antibody (NBP3-24794).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DNA polymerase mu Antibody (NBP3-24794) (0)
There are no reviews for DNA polymerase mu Antibody (NBP3-24794).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DNA polymerase mu Antibody (NBP3-24794) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DNA polymerase mu Products
Research Areas for DNA polymerase mu Antibody (NBP3-24794)
Find related products by research area.
|
Blogs on DNA polymerase mu