DNA Polymerase epsilon p59 Antibody - BSA Free

Western Blot: DNA Polymerase epsilon p59 Antibody [NBP2-84797] - Host: Rabbit. Target Name: POLE2. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DNA Polymerase epsilon p59 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNA Polymerase epsilon p59 Antibody - BSA Free (NBP2-84797) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DNA Polymerase epsilon p59. Peptide sequence: NINFFGGPSNTSVKTSAKLKQLEEENKDAMFVFLSDVWLDQVEVLEKLRI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLE2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DNA Polymerase epsilon p59 Antibody - BSA Free

• DNA polymerase epsilon subunit 2
• DNA polymerase II subunit 2
• DPE2DNA polymerase epsilon subunit B
• EC 2.7.7.7
• polymerase (DNA directed), epsilon 2 (p59 subunit)

Background

Participates in DNA repair and in chromosomal DNA replication

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLE2