DNA Polymerase epsilon p59 Antibody

Images

 
Western Blot: DNA Polymerase epsilon p59 Antibody [NBP1-87970] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: DNA Polymerase epsilon p59 Antibody [NBP1-87970] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & vesicles.
Immunohistochemistry-Paraffin: DNA Polymerase epsilon p59 Antibody [NBP1-87970] - Staining of human tonsil shows moderate nuclear positivity in germinal center and non-germinal center cells..
Western Blot: DNA Polymerase epsilon p59 Antibody [NBP1-87970] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA Polymerase epsilon p59 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NAVEKQPLSSNMIERSVVEAAVQECSQSVDETIEHVFNIIGAFDIPRFVYNSERKKFLPLLMTNHPAPNLFGTPRDKAEMFRERYTILHQRTHRHELFTPPVIGSHPDESGSKFQLKTIETLLGSTTKIGDAIVLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Polymerase epsilon p59 Protein (NBP1-87970PEP)
Publications
Read Publication using
NBP1-87970 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25487575). Mouse (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNA Polymerase epsilon p59 Antibody

  • DNA polymerase epsilon subunit 2
  • DNA polymerase II subunit 2
  • DPE2DNA polymerase epsilon subunit B
  • EC 2.7.7.7
  • polymerase (DNA directed), epsilon 2 (p59 subunit)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85281
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF5510
Species: Hu
Applications: WB
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-82139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-69312
Species: Hu
Applications: WB, IHC, IHC-P
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for DNA Polymerase epsilon p59 Antibody (NBP1-87970)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DNA Polymerase epsilon p59 Antibody (NBP1-87970) (0)

There are no reviews for DNA Polymerase epsilon p59 Antibody (NBP1-87970). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNA Polymerase epsilon p59 Antibody (NBP1-87970) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA Polymerase epsilon p59 Products

Bioinformatics Tool for DNA Polymerase epsilon p59 Antibody (NBP1-87970)

Discover related pathways, diseases and genes to DNA Polymerase epsilon p59 Antibody (NBP1-87970). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Polymerase epsilon p59 Antibody (NBP1-87970)

Discover more about diseases related to DNA Polymerase epsilon p59 Antibody (NBP1-87970).
 

Pathways for DNA Polymerase epsilon p59 Antibody (NBP1-87970)

View related products by pathway.

PTMs for DNA Polymerase epsilon p59 Antibody (NBP1-87970)

Learn more about PTMs related to DNA Polymerase epsilon p59 Antibody (NBP1-87970).
 

Research Areas for DNA Polymerase epsilon p59 Antibody (NBP1-87970)

Find related products by research area.

Blogs on DNA Polymerase epsilon p59

There are no specific blogs for DNA Polymerase epsilon p59, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Polymerase epsilon p59 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLE2