DNA Polymerase epsilon catalytic subunit A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DNA Polymerase epsilon catalytic subunit A Antibody [NBP2-55332] - Staining of human cell line HEK 293 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNA Polymerase epsilon catalytic subunit A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HLQRHNHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTILQSHHVNDMEGADSMGISFDVIQ
Specificity
Specificity of human DNA Polymerase epsilon catalytic subunit A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLE
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNA Polymerase epsilon catalytic subunit A Recombinant Protein Antigen (NBP2-55332PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DNA Polymerase epsilon catalytic subunit A Antibody

  • DKFZp434F222
  • DNA polymerase epsilon catalytic subunit A
  • DNA polymerase II subunit A
  • EC 2.7.7
  • EC 2.7.7.7
  • POLE1FLJ21434
  • polymerase (DNA directed), epsilon

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92951
Species: Hu, Mu
Applications: WB, ICC/IF, KO
NB100-74611
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-93562
Species: Hu
Applications: WB
AF2535
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-16391
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-92952
Species: Hu, Mu, Rt
Applications: WB, IHC, KO
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBL1-15012
Species: Hu
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA, Flow-IC
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
AF6457
Species: Hu
Applications: WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332) (0)

There are no publications for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332) (0)

There are no reviews for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DNA Polymerase epsilon catalytic subunit A Products

Bioinformatics Tool for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332)

Discover related pathways, diseases and genes to DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332)

Discover more about diseases related to DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332).
 

Pathways for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332)

View related products by pathway.

PTMs for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332)

Learn more about PTMs related to DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332).
 

Research Areas for DNA Polymerase epsilon catalytic subunit A Antibody (NBP2-55332)

Find related products by research area.

Blogs on DNA Polymerase epsilon catalytic subunit A

There are no specific blogs for DNA Polymerase epsilon catalytic subunit A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Polymerase epsilon catalytic subunit A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLE