DNA Ligase I Recombinant Protein Antigen

Images

 
There are currently no images for DNA Ligase I Recombinant Protein Antigen (NBP2-55992PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DNA Ligase I Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNA Ligase I.

Source: E. coli

Amino Acid Sequence: RNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LIG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55992.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNA Ligase I Recombinant Protein Antigen

  • DNA ligase 1
  • DNA Ligase I
  • EC 6.5.1.1
  • ligase I, DNA, ATP-dependent
  • MGC117397
  • MGC130025
  • Polydeoxyribonucleotide synthase [ATP] 1
  • polydeoxyribonucleotide synthase ATP 1

Background

DNA ligase 1 catalyzes the joining of double-stranded DNA ends during replication, recombination, and repair. Structurally, DNA ligase 1 is toroidal and encircles nicked DNA substrates. The 9-1-1 complex, a DNA damage checkpoint complex, has been reported to associate with DNA ligase 1 and stimulate ligase activity. Mutations in DNA ligase 1 result in immunodeficiency and increased sensitivity to DNA-damaging agents.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87154
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-41190
Species: Ch, Hu, Mu
Applications: B/N, ICC/IF, IP, PLA, WB
AF3495
Species: Hu
Applications: IHC, WB
NB100-119
Species: Hu, Mu
Applications: ICC/IF,  IHC-P, IP, In vitro, RIA, WB
NBP3-15704
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-41190
Species: Ch, Hu, Mu
Applications: B/N, ICC/IF, IP, PLA, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, PLA, Simple Western, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP2-38600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89463
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-477
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF3688
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NB100-150
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, Simple Western, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
NBP2-55992PEP
Species: Hu
Applications: AC

Publications for DNA Ligase I Recombinant Protein Antigen (NBP2-55992PEP) (0)

There are no publications for DNA Ligase I Recombinant Protein Antigen (NBP2-55992PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Ligase I Recombinant Protein Antigen (NBP2-55992PEP) (0)

There are no reviews for DNA Ligase I Recombinant Protein Antigen (NBP2-55992PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNA Ligase I Recombinant Protein Antigen (NBP2-55992PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNA Ligase I Products

Research Areas for DNA Ligase I Recombinant Protein Antigen (NBP2-55992PEP)

Find related products by research area.

Blogs on DNA Ligase I.

Using PCNA as an Antibody Marker
PCNA antibodies are useful biomarkers in DNA repair studies. PCNA is one of several proteins essential for the completion of nucleotide excision repair, a multi-stage process involving 20 - 30 proteins, and an important factor in repairing damage and ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNA Ligase I Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LIG1