DLX2 Antibody (4B9)

Images

 
Western Blot: DLX2 Antibody (4B9) [H00001746-M02] - DLX2 monoclonal antibody (M02), clone 4B9 Analysis of DLX2 expression in NIH/3T3.
Immunohistochemistry-Paraffin: DLX2 Antibody (4B9) [H00001746-M02] - Analysis of monoclonal antibody to DLX2 on formalin-fixed paraffin-embedded human lung. Antibody concentration 1 ug/ml.
Sandwich ELISA: DLX2 Antibody (4B9) [H00001746-M02] - Detection limit for recombinant GST tagged DLX2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

DLX2 Antibody (4B9) Summary

Immunogen
DLX2 (NP_004396.1, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDL
Marker
Neural Crest Marker
Specificity
DLX2 - distal-less homeobox 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DLX2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DLX2 Antibody (4B9)

  • distal-less homeo box 2
  • distal-less homeobox 2
  • homeobox protein DLX-2
  • TES1
  • TES-1

Background

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
NBP1-85929
Species: Hu
Applications: WB, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
355-BM/CF
Species: Hu, Mu, Rt
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
423-F8/CF
Species: Hu, Mu
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB3314
Species: Hu, Rt
Applications: IHC
AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
H00001746-M02
Species: Hu, Mu
Applications: WB, ELISA, IHC-P

Publications for DLX2 Antibody (H00001746-M02) (0)

There are no publications for DLX2 Antibody (H00001746-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLX2 Antibody (H00001746-M02) (0)

There are no reviews for DLX2 Antibody (H00001746-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLX2 Antibody (H00001746-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DLX2 Products

Bioinformatics Tool for DLX2 Antibody (H00001746-M02)

Discover related pathways, diseases and genes to DLX2 Antibody (H00001746-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLX2 Antibody (H00001746-M02)

Discover more about diseases related to DLX2 Antibody (H00001746-M02).
 

Pathways for DLX2 Antibody (H00001746-M02)

View related products by pathway.

PTMs for DLX2 Antibody (H00001746-M02)

Learn more about PTMs related to DLX2 Antibody (H00001746-M02).

Blogs on DLX2

There are no specific blogs for DLX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLX2 Antibody (4B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX2
Entrez
OMIM
Uniprot