Dlx1 Antibody

Images

 
Western Blot: Dlx1 Antibody [NBP1-98334] - Antibody Dilution: 1.0ug/ml Sample Tissue: Rat Pancreas.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dlx1 Antibody Summary

Immunogen
The immunogen for this antibody is Dlx1 - C-terminal region. Peptide sequence SAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM.
Clonality
Polyclonal
Host
Rabbit
Gene
DLX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dlx1 Antibody

  • distal-less homeo box 1
  • distal-less homeobox 1
  • homeobox protein DLX-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00001749-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85929
Species: Hu
Applications: WB, IHC, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
AF7068
Species: Hu
Applications: WB, IHC, ICC
NBP1-87022
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP1-90973
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-98334
Species: Rt
Applications: WB

Publications for Dlx1 Antibody (NBP1-98334) (0)

There are no publications for Dlx1 Antibody (NBP1-98334).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dlx1 Antibody (NBP1-98334) (0)

There are no reviews for Dlx1 Antibody (NBP1-98334). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dlx1 Antibody (NBP1-98334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dlx1 Antibody Products

Related Products by Gene

Bioinformatics Tool for Dlx1 Antibody (NBP1-98334)

Discover related pathways, diseases and genes to Dlx1 Antibody (NBP1-98334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dlx1 Antibody (NBP1-98334)

Discover more about diseases related to Dlx1 Antibody (NBP1-98334).
 

Pathways for Dlx1 Antibody (NBP1-98334)

View related products by pathway.

PTMs for Dlx1 Antibody (NBP1-98334)

Learn more about PTMs related to Dlx1 Antibody (NBP1-98334).

Blogs on Dlx1

There are no specific blogs for Dlx1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dlx1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX1
Uniprot

Customers Who Bought This Also Bought