Dishevelled-3 Antibody - BSA Free

Western Blot: Dishevelled-3 Antibody [NBP2-38846] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunocytochemistry/Immunofluorescence: Dishevelled-3 Antibody [NBP2-38846] - Staining of human cell line CACO-2 shows positivity in cytokinetic bridge and centrosome.

Immunohistochemistry-Paraffin: Dishevelled-3 Antibody [NBP2-38846] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Dishevelled-3 Antibody [NBP2-38846] - Staining of human fallopian tube shows moderate positivity in glandular cells.

Immunohistochemistry-Paraffin: Dishevelled-3 Antibody [NBP2-38846] - Staining of human small intestine shows moderate positivity in glandular cells.

Immunohistochemistry-Paraffin: Dishevelled-3 Antibody [NBP2-38846] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dishevelled-3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREP
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DVL3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Dishevelled-3 Protein (NBP2-38846PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Dishevelled-3 Antibody - BSA Free

• dishevelled 3 (homologous to Drosophila dsh)
• dishevelled, dsh homolog 3 (Drosophila)
• Dishevelled3
• Dishevelled-3
• DSH homolog 3
• DVL3
• KIAA0208dishevelled-3
• segment polarity protein dishevelled homolog DVL-3

Background

Dishevelled 3 is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DVL3
• Uniprot:
  • Q92997()