Vang-like Protein 1/VANGL1 Antibody

Images

 
Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VANGL1 antibody. Remaining relative intensity is ...read more
Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Staining of human kidney shows moderate membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

Vang-like Protein 1/VANGL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VANGL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Vang-like Protein 1/VANGL1 Protein (NBP1-86990PEP)
Publications
Read Publications using
NBP1-86990 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22935613)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vang-like Protein 1/VANGL1 Antibody

  • KAI1 C-terminal interacting tetraspanin
  • Loop-tail protein 2 homolog
  • LPP2
  • MGC5338
  • STB2
  • STB2KITENIN
  • STBM2
  • Strabismus 2
  • Van Gogh-like protein 1
  • vang (van gogh, Drosophila)-like 1, vang, van gogh-like 1 (Drosophila)
  • Vang like Protein 1
  • VANGL1
  • vang-like 1 (van gogh, Drosophila)
  • Vang-like Protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-45378
Species: Hu
Applications: WB, IHC
3669-WN/CF
Species: Mu
NBP1-30656
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-13230
Species: Hu
Applications: IHC, IHC-P
NBP2-57350
Species: Hu
Applications: WB, ICC/IF
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-86990
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)(4)

Reviews for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990) (0)

There are no reviews for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Vang-like Protein 1/VANGL1 Products

Bioinformatics Tool for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

Discover related pathways, diseases and genes to Vang-like Protein 1/VANGL1 Antibody (NBP1-86990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

Discover more about diseases related to Vang-like Protein 1/VANGL1 Antibody (NBP1-86990).
 

Pathways for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

View related products by pathway.

PTMs for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

Learn more about PTMs related to Vang-like Protein 1/VANGL1 Antibody (NBP1-86990).
 

Research Areas for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

Find related products by research area.

Blogs on Vang-like Protein 1/VANGL1

There are no specific blogs for Vang-like Protein 1/VANGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vang-like Protein 1/VANGL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VANGL1
Entrez