Vang-like Protein 1/VANGL1 Antibody

Images

 
Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in control (vector only transfected HEK293T lysate) and VANGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunocytochemistry/ Immunofluorescence: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Staining of MCF7 cells shows localization to plasma membrane. Antibody staining is shown in green.
Genetic Strategies: Western Blot: Vang-like Protein 1/VANGL1 Antibody [NBP1-86990] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-VANGL1 antibody. ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Vang-like Protein 1/VANGL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRY
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VANGL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
Vang-like Protein 1/VANGL1 Protein (NBP1-86990PEP)
Publications
Read Publications using
NBP1-86990 in the following applications:

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 25837385).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Vang-like Protein 1/VANGL1 Antibody

  • KAI1 C-terminal interacting tetraspanin
  • Loop-tail protein 2 homolog
  • LPP2
  • MGC5338
  • STB2
  • STB2KITENIN
  • STBM2
  • Strabismus 2
  • Van Gogh-like protein 1
  • vang (van gogh, Drosophila)-like 1, vang, van gogh-like 1 (Drosophila)
  • Vang like Protein 1
  • VANGL1
  • vang-like 1 (van gogh, Drosophila)
  • Vang-like Protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
AF6278
Species: Hu, Mu
Applications: WB
AF7164
Species: Hu
Applications: WB
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP, IF
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Av-Du, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-45378
Species: Hu
Applications: WB, IHC
3669-WN/CF
Species: Mu
NBP2-49082
Species: Hu
Applications: IHC, IHC-P
NLS5103
Species: Hu, Bv, Ca
Applications: IHC, IHC-P, ICC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP3-05610
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-33639
Species: Hu
Applications: IHC, IHC-P
NBP2-93554
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1001
Species: Mu
Applications: IHC

Publications for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)(4)

Reviews for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990) (0)

There are no reviews for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Vang-like Protein 1/VANGL1 Products

Bioinformatics Tool for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

Discover related pathways, diseases and genes to Vang-like Protein 1/VANGL1 Antibody (NBP1-86990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

Discover more about diseases related to Vang-like Protein 1/VANGL1 Antibody (NBP1-86990).
 

Pathways for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

View related products by pathway.

PTMs for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

Learn more about PTMs related to Vang-like Protein 1/VANGL1 Antibody (NBP1-86990).
 

Research Areas for Vang-like Protein 1/VANGL1 Antibody (NBP1-86990)

Find related products by research area.

Blogs on Vang-like Protein 1/VANGL1

There are no specific blogs for Vang-like Protein 1/VANGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Vang-like Protein 1/VANGL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VANGL1