DIP13B Antibody

Images

 
Immunohistochemistry-Paraffin: DIP13B Antibody [NBP2-14304] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DIP13B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGN PNEHRGAESEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APPL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DIP13B Protein (NBP2-14304PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIP13B Antibody

  • Adapter protein containing PH domain, PTB domain and leucine zipper motif 2
  • adaptor protein containing PH domain, PTB domain and leucine zipper motif 2
  • adaptor protein, phosphotyrosine interaction, PH domain and leucine zippercontaining 2
  • DCC-interacting protein 13-beta
  • DIP13BDIP13 beta
  • Dip13-beta
  • FLJ10659dip13-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7075
Species: Hu
Applications: WB
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-28641
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC, IHC-P
NBP1-28640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15564
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for DIP13B Antibody (NBP2-14304) (0)

There are no publications for DIP13B Antibody (NBP2-14304).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIP13B Antibody (NBP2-14304) (0)

There are no reviews for DIP13B Antibody (NBP2-14304). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIP13B Antibody (NBP2-14304) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIP13B Products

Bioinformatics Tool for DIP13B Antibody (NBP2-14304)

Discover related pathways, diseases and genes to DIP13B Antibody (NBP2-14304). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIP13B Antibody (NBP2-14304)

Discover more about diseases related to DIP13B Antibody (NBP2-14304).
 

Pathways for DIP13B Antibody (NBP2-14304)

View related products by pathway.

PTMs for DIP13B Antibody (NBP2-14304)

Learn more about PTMs related to DIP13B Antibody (NBP2-14304).

Blogs on DIP13B

There are no specific blogs for DIP13B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIP13B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APPL2