Home » Dicer » Dicer Proteins » Dicer Recombinant Protein Antigen

Dicer Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Dicer Recombinant Protein Antigen (NBP2-30699PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Dicer Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DICER1.

Source: E.coli

Amino Acid Sequence: PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DICER1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-30699. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Dicer Recombinant Protein Antigen

  • DCR1
  • dicer 1, double-stranded RNA-specific endoribonuclease
  • dicer 1, ribonuclease type III
  • Dicer
  • Dicer1, Dcr-1 homolog (Drosophila)
  • EC 3.1.26
  • EC 3.1.26.-
  • EC 3.1.26.3
  • Helicase MOI
  • Helicase with RNase motif
  • helicase-moi
  • HERNADicer1, Dcr-1 homolog
  • K12H4.8-LIKE
  • KIAA0928endoribonuclease Dicer

Background

Dicer encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Drosha Antibody
NBP1-03349
Immunoprecipitation: Drosha Antibody [NBP1-03349] - Detection of human Drosha by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-Drosha antibody NBP1-03349 used for IP at 6 ug per reaction. Drosha was also immunoprecipitated by another rabbit anti-Drosha antibody. For blotting immunoprecipitated Drosha, NBP1-03349 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Western Blot: Drosha Antibody [NBP1-03349] - Detection of Human Drosha by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Drosha antibody NBP1-03349 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
(3 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
RISC Antibody
NB100-56648
Western Blot: RISC Antibody [NB100-56648] - Analysis of human RISC in 15 ugs of human heart cell lysate using NB100-56648 at 1:1000 dilution.
Species: Hu, Mu, Rt
Applications: WB
TRBP Antibody
NBP2-24725
Western Blot: TRBP Antibody [NBP2-24725] - Analysis of TRBP in human brain lysate in the 1) absence, 2) presence of immunizing peptide using this antibody at 6 ug/ml.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using control (rabbit Ig) at 5 ug/ml.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-24725] - IHC staining of normal human brain using this antibody at 5 ug/ml.
(1 Publication)
Species: Eq, Hu, Pm
Applications: IHC, IHC-P, WB
DGCR8 knockout
Mouse embryonic stem ...
NBA1-19349
Immunocytochemistry/Immunofluorescence: DGCR8 knockout Mouse embryonic stem cells [NBA1-19349] - Nanog antibody (NB100-58842) was tested in with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunocytochemistry/Immunofluorescence: DGCR8 knockout Mouse embryonic stem cells [NBA1-19349] - SSEA1 antibody (NB100-1831) was tested in with DyLight 488 (green). Nuclei and beta-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
In vitro assay: DGCR8 knockout Mouse embryonic stem cells [NBA1-19349] - Brightfield Image of DGCR8 knockout Mouse embryonic stem cell [NBA1-19349] colonies growing directly on a gelatinized tissue culture flask.
(13 Publications)
Species: Mu
Applications: Flow, ICC/IF, In vitro
NCOA6 Antibody
NB200-335
Western Blot: NCOA6 Antibody [NB200-335] - Detection of Human ASC2 by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-ASC2 antibody NB200-335 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunohistochemistry-Paraffin: NCOA6 Antibody [NB200-335] - FFPE section of human colon carcinoma. Antibody: Affinity purified rabbit anti-ASC2 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: NCOA6 Antibody [NB200-335] - Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-ASC2 antibody used for IP at 6 ug per reaction. ASC2 was also immunoprecipitated by a previous lot of this antibody and rabbit anti-ASC2 antibody. For blotting immunoprecipitated ASC2, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(7 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
Exportin-5 Antibody
NBP1-89606
Immunocytochemistry/Immunofluorescence: Exportin-5 Antibody [NBP1-89606] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Exportin-5 Antibody [NBP1-89606] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Exportin-5 Antibody [NBP1-89606] - Staining of human testis shows high expression.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
FBXW7/Cdc4 Antibody
NBP1-59631
Immunohistochemistry: FBXW7/Cdc4 Antibody [NBP1-59631] - Kidney
Immunohistochemistry: FBXW7/Cdc4 Antibody [NBP1-59631] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: FBXW7/Cdc4 Antibody [NBP1-59631] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
FMRP Antibody
(OTI1C6)
NBP2-01770
Flow Cytometry: FMRP Antibody (1C6) [NBP2-01770] - Analysis of Jurkat cells, using anti-FMRP antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Western Blot: FMRP Antibody (1C6) [NBP2-01770] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY FMRP (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-FMRP.
Immunohistochemistry-Paraffin: FMRP Antibody (1C6) [NBP2-01770] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-FMRP mouse monoclonal antibody.
(1 Review)
(2 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PIWIL1/HIWI
Antibody
AF6548
PIWIL1/HIWI was detected in perfusion fixed frozen sections of mouse testes using Goat Anti-Human PIWIL1/HIWI Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6548) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to the cytoplasm of spermatocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Hu, Mu
Applications: IHC
CD302/CLEC13A
Antibody
AF6367
Western blot shows lysates of HL‑60 human acute promyelocytic leukemia cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human CD302/CLEC13A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6367) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CD302/CLEC13A at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Human peripheral blood monocytes were stained with Sheep Anti-Human CD302/CLEC13A Affinity Purified Polyclonal Antibody (Catalog # AF6367, filled histogram) or control antibody (Catalog # 5‑001‑A, open histogram), followed by Phycoerythrin-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # F0126).
Species: Hu
Applications: CyTOF-ready, Flow, WB
LIN-28A Antibody
[Unconjugated]
AF3757
LIN‑28A was detected in immersion fixed BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human LIN‑28A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3757) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counter­stained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
LIN‑28A was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human LIN‑28A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3757) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of JAR human choriocarcinoma cell line and NTera‑2 human testicular embryonic carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human LIN‑28A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3757) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for LIN‑28A at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(12 Publications)
Species: Hu
Applications: ICC, WB
PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Simple Western lane view shows lysates of K562 human chronic myelogenous leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for PKR at approximately 73 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
PKR was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line stimulated with rhIFN-alpha (Catalog # 11110-1) using Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PKR at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(5 Publications)
Species: Hu
Applications: ICC, IP, Simple Western, WB

TRAILR4/TNFRSF10D/DcR2 ...
NBP1-76985
Western Blot: TRAILR4/TNFRSF10D/DcR2 Antibody [NBP1-76985] - Analysis of 50 ug of whole cell lysate from HeLa cells with anti-DcR2 at 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: TRAILR4/TNFRSF10D/DcR2 Antibody [NBP1-76985] - Staining of HeLa cells using DcR2 antibody at 10ug/ml.
Immunocytochemistry/Immunofluorescence: TRAILR4/TNFRSF10D/DcR2 Antibody [NBP1-76985] - Analysis of DcR2 in mouse kidney tissue withDcR2 antibody at 20 ug/ml.
(20 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-P, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.
(2 Reviews)
(24 Publications)
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
SLC1A5 Antibody
NBP1-89327
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human rectum shows moderate to strong membranous positivity in glandular cells.
(1 Review)
(4 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
VEGF [HRP]
DVE00
(625 Publications)
Species: Hu
Applications: ELISA
Dicer Recombinant
Protein Antigen
NBP2-30699PEP
Dicer Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Dicer Recombinant Protein Antigen (NBP2-30699PEP) (0)

There are no publications for Dicer Recombinant Protein Antigen (NBP2-30699PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dicer Recombinant Protein Antigen (NBP2-30699PEP) (0)

There are no reviews for Dicer Recombinant Protein Antigen (NBP2-30699PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dicer Recombinant Protein Antigen (NBP2-30699PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dicer Products

Array NBP2-30699PEP

Bioinformatics Tool for Dicer Recombinant Protein Antigen (NBP2-30699PEP)

Discover related pathways, diseases and genes to Dicer Recombinant Protein Antigen (NBP2-30699PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dicer Recombinant Protein Antigen (NBP2-30699PEP)

Discover more about diseases related to Dicer Recombinant Protein Antigen (NBP2-30699PEP).
 

Pathways for Dicer Recombinant Protein Antigen (NBP2-30699PEP)

View related products by pathway.

PTMs for Dicer Recombinant Protein Antigen (NBP2-30699PEP)

Learn more about PTMs related to Dicer Recombinant Protein Antigen (NBP2-30699PEP).
 

Research Areas for Dicer Recombinant Protein Antigen (NBP2-30699PEP)

Find related products by research area.

Blogs on Dicer.

Check out the latest blog posts on Dicer.
Slicing and Dicing RNA with Dicer
Dicer is an RNaseIII-like enzyme capable of cleaving double-stranded RNA (dsRNA) into smaller 21-23 nt RNA fragments known as short interfering RNA (siRNAs). It targets the selective degradation of complementary RNAs in a posttranscriptional gene sile...  Read full blog post.
Ago2 antibodies and dicer-independent biogenesis of miRNA
Ago2, also called eIF2C2, antibody is one of 37 reagents targeted to the Argonaute protein family that we at Novus Biologicals have in our antibody catalogue. Argonaute proteins are encoded by genes which play an important role in regulating the contr...  Read full blog post.

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dicer Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DICER1