Dicer Recombinant Protein Antigen

Images

 
There are currently no images for Dicer Recombinant Protein Antigen (NBP2-30699PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dicer Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DICER1.

Source: E. coli

Amino Acid Sequence: PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DICER1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30699.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dicer Recombinant Protein Antigen

  • DCR1
  • dicer 1, double-stranded RNA-specific endoribonuclease
  • dicer 1, ribonuclease type III
  • Dicer
  • Dicer1, Dcr-1 homolog (Drosophila)
  • EC 3.1.26
  • EC 3.1.26.-
  • EC 3.1.26.3
  • Helicase MOI
  • Helicase with RNase motif
  • helicase-moi
  • HERNADicer1, Dcr-1 homolog
  • K12H4.8-LIKE
  • KIAA0928endoribonuclease Dicer

Background

Dicer encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-03349
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NB100-56648
Species: Hu, Mu, Rt
Applications: WB
NBP3-16753
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBA1-19349
Species: Mu
Applications: Flow, ICC/IF, In vitro, In vivo
NB200-335
Species: Hu
Applications: IHC,  IHC-P, IP, WB
H00057510-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
H00055294-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF6548
Species: Hu, Mu
Applications: IHC
AF6367
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF3757
Species: Hu
Applications: ICC, Simple Western, WB
H00008575-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP1-76985
Species: Hu, Mu, Rt
Applications: ELISA, Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP1-89327
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-30699PEP
Species: Hu
Applications: AC

Publications for Dicer Recombinant Protein Antigen (NBP2-30699PEP) (0)

There are no publications for Dicer Recombinant Protein Antigen (NBP2-30699PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dicer Recombinant Protein Antigen (NBP2-30699PEP) (0)

There are no reviews for Dicer Recombinant Protein Antigen (NBP2-30699PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dicer Recombinant Protein Antigen (NBP2-30699PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dicer Products

Research Areas for Dicer Recombinant Protein Antigen (NBP2-30699PEP)

Find related products by research area.

Blogs on Dicer.

Slicing and Dicing RNA with Dicer
Dicer is an RNaseIII-like enzyme capable of cleaving double-stranded RNA (dsRNA) into smaller 21-23 nt RNA fragments known as short interfering RNA (siRNAs). It targets the selective degradation of complementary RNAs in a posttranscriptional gene sile...  Read full blog post.

Ago2 antibodies and dicer-independent biogenesis of miRNA
Ago2, also called eIF2C2, antibody is one of 37 reagents targeted to the Argonaute protein family that we at Novus Biologicals have in our antibody catalogue. Argonaute proteins are encoded by genes which play an important role in regulating the contr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dicer Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DICER1