| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1813-1912 of Human Dicer Source: Wheat Germ (in vitro) Amino Acid Sequence: ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | DICER1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Dicer Partial Recombinant Protein (H00023405-Q01)Find related products by research area.
|
|
Slicing and Dicing RNA with Dicer Dicer is an RNaseIII-like enzyme capable of cleaving double-stranded RNA (dsRNA) into smaller 21-23 nt RNA fragments known as short interfering RNA (siRNAs). It targets the selective degradation of complementary RNAs in a posttranscriptional gene sile... Read full blog post. |
|
Ago2 antibodies and dicer-independent biogenesis of miRNA Ago2, also called eIF2C2, antibody is one of 37 reagents targeted to the Argonaute protein family that we at Novus Biologicals have in our antibody catalogue. Argonaute proteins are encoded by genes which play an important role in regulating the contr... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DICER1 |