Recombinant Human Dicer GST (N-Term) Protein

Images

 
Recombinant Human Dicer Protein [H00023405-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Dicer GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1813-1912 of Human Dicer

Source: Wheat Germ (in vitro)

Amino Acid Sequence: ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DICER1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dicer GST (N-Term) Protein

  • DCR1
  • dicer 1, double-stranded RNA-specific endoribonuclease
  • dicer 1, ribonuclease type III
  • Dicer
  • Dicer1, Dcr-1 homolog (Drosophila)
  • EC 3.1.26
  • EC 3.1.26.-
  • EC 3.1.26.3
  • Helicase MOI
  • Helicase with RNase motif
  • helicase-moi
  • HERNADicer1, Dcr-1 homolog
  • K12H4.8-LIKE
  • KIAA0928endoribonuclease Dicer

Background

DICER1 - Dicer1, Dcr-1 homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Dicer Partial Recombinant Protein (H00023405-Q01) (0)

There are no publications for Dicer Partial Recombinant Protein (H00023405-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dicer Partial Recombinant Protein (H00023405-Q01) (0)

There are no reviews for Dicer Partial Recombinant Protein (H00023405-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dicer Partial Recombinant Protein (H00023405-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dicer Products

Array H00023405-Q01

Research Areas for Dicer Partial Recombinant Protein (H00023405-Q01)

Find related products by research area.

Blogs on Dicer.

Slicing and Dicing RNA with Dicer
Dicer is an RNaseIII-like enzyme capable of cleaving double-stranded RNA (dsRNA) into smaller 21-23 nt RNA fragments known as short interfering RNA (siRNAs). It targets the selective degradation of complementary RNAs in a posttranscriptional gene sile...  Read full blog post.

Ago2 antibodies and dicer-independent biogenesis of miRNA
Ago2, also called eIF2C2, antibody is one of 37 reagents targeted to the Argonaute protein family that we at Novus Biologicals have in our antibody catalogue. Argonaute proteins are encoded by genes which play an important role in regulating the contr...  Read full blog post.

mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dicer GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DICER1