Recombinant Human Dicer Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Dicer Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1813-1912 of Human DICER1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DICER1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dicer Protein

  • DCR1
  • dicer 1, double-stranded RNA-specific endoribonuclease
  • dicer 1, ribonuclease type III
  • Dicer
  • Dicer1, Dcr-1 homolog (Drosophila)
  • EC 3.1.26
  • EC 3.1.26.-
  • EC 3.1.26.3
  • Helicase MOI
  • Helicase with RNase motif
  • helicase-moi
  • HERNADicer1, Dcr-1 homolog
  • K12H4.8-LIKE
  • KIAA0928endoribonuclease Dicer

Background

DICER1 - Dicer1, Dcr-1 homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6548
Species: Hu, Mu
Applications: IHC
AF6367
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF3757
Species: Hu
Applications: WB, ICC
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-76985
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Dicer Partial Recombinant Protein (H00023405-Q01) (0)

There are no publications for Dicer Partial Recombinant Protein (H00023405-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dicer Partial Recombinant Protein (H00023405-Q01) (0)

There are no reviews for Dicer Partial Recombinant Protein (H00023405-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dicer Partial Recombinant Protein (H00023405-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dicer Products

Bioinformatics Tool for Dicer Partial Recombinant Protein (H00023405-Q01)

Discover related pathways, diseases and genes to Dicer Partial Recombinant Protein (H00023405-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dicer Partial Recombinant Protein (H00023405-Q01)

Discover more about diseases related to Dicer Partial Recombinant Protein (H00023405-Q01).
 

Pathways for Dicer Partial Recombinant Protein (H00023405-Q01)

View related products by pathway.

PTMs for Dicer Partial Recombinant Protein (H00023405-Q01)

Learn more about PTMs related to Dicer Partial Recombinant Protein (H00023405-Q01).
 

Research Areas for Dicer Partial Recombinant Protein (H00023405-Q01)

Find related products by research area.

Blogs on Dicer.

Slicing and Dicing RNA with Dicer
Dicer is an RNaseIII-like enzyme capable of cleaving double-stranded RNA (dsRNA) into smaller 21-23 nt RNA fragments known as short interfering RNA (siRNAs). It targets the selective degradation of complementary RNAs in a posttranscriptional gene sile...  Read full blog post.

Ago2 antibodies and dicer-independent biogenesis of miRNA
Ago2, also called eIF2C2, antibody is one of 37 reagents targeted to the Argonaute protein family that we at Novus Biologicals have in our antibody catalogue. Argonaute proteins are encoded by genes which play an important role in regulating the contr...  Read full blog post.

Customers Who Bought This Also Bought

Dicer Antibody
NBP1-06520
c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dicer Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DICER1